|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Spipo21G0015100 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
Family |
WRKY |
Protein Properties |
Length: 105aa MW: 12429.3 Da PI: 10.4677 |
Description |
WRKY family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Spipo21G0015100 | genome | MIPS/IBIS | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | WRKY | 104.2 | 7e-33 | 28 | 86 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
Spipo21G0015100 28 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLAEDPRMVITTYEGRHIHS 86
59********************************************************7 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:1901141 | Biological Process | regulation of lignin biosynthetic process |
GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation |
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AK108755 | 3e-90 | AK108755.1 Oryza sativa Japonica Group cDNA clone:002-150-F11, full insert sequence. |
GenBank | AY341853 | 3e-90 | AY341853.1 Oryza sativa (japonica cultivar-group) WRKY12 mRNA, complete cds. |