PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo19G0012000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 187aa MW: 20125 Da PI: 8.1238 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 142.7 | 1.2e-44 | 10 | 109 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++l +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++el Spipo19G0012000 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFSNVHKIFGASNVTKLLNDLLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVQRLQKEL 103 7********************************************************************************************* PP DUF260 95 allkee 100 +++++e Spipo19G0012000 104 DAANAE 109 999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.89 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 8.0E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MASSNTSYSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFS NVHKIFGASN VTKLLNDLLP 60 HQREDAVNSL AYEAEARIKD PVYGCVGAIS VLQRQVQRLQ KELDAANAEL LRYACNDIPT 120 GMPVGTLVAS PSSVATHQGI EFRRVIANGG GSFFPIAGLP ISFSPAWGGT TISADLGERQ 180 RGENHI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-72 | 9 | 126 | 10 | 130 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-72 | 9 | 126 | 10 | 130 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010940136.1 | 2e-91 | LOB domain-containing protein 25 | ||||
Refseq | XP_029124379.1 | 2e-91 | LOB domain-containing protein 25 | ||||
Refseq | XP_029124380.1 | 2e-91 | LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 2e-71 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2H3ZTC7 | 1e-89 | A0A2H3ZTC7_PHODC; LOW QUALITY PROTEIN: LOB domain-containing protein 25-like | ||||
STRING | XP_008795982.1 | 2e-90 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8813 | 35 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 9e-74 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo19G0012000 |
Publications ? help Back to Top | |||
---|---|---|---|
|