![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo19G0011900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 162aa MW: 17782.6 Da PI: 9.0561 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144.1 | 4.2e-45 | 14 | 113 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrrkC+++C++apyfp e+p+kf nvhk+FGasnv+kll++l +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++el Spipo19G0011900 14 PCAACKFLRRKCTPSCIFAPYFPPEEPQKFSNVHKIFGASNVTKLLNDLLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVQRLQKEL 107 7********************************************************************************************* PP DUF260 95 allkee 100 +++++e Spipo19G0011900 108 DAANAE 113 999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 28.022 | 13 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.8E-44 | 14 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MQRGMASSNT SYSPCAACKF LRRKCTPSCI FAPYFPPEEP QKFSNVHKIF GASNVTKLLN 60 DLLPHQREDA VNSLAYEAEA RIKDPVYGCV GAISVLQRQV QRLQKELDAA NAELLRYACN 120 DIPTGMPVGP LVARLSPDTL RILPLAGLHH ARAEAKHIKV Q* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-70 | 13 | 128 | 10 | 128 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-70 | 13 | 128 | 10 | 128 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021292136.1 | 3e-79 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_021292137.1 | 3e-79 | protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 6e-69 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2U1Q2L9 | 2e-77 | A0A2U1Q2L9_ARTAN; LOB domain-containing protein | ||||
STRING | EOY20851 | 6e-78 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8813 | 35 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-71 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo19G0011900 |
Publications ? help Back to Top | |||
---|---|---|---|
|