PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

HD-ZIP

Protein Properties

Length: 129aa MW: 14495.2 Da PI: 5.0893

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo15G0017300	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	60.8	2.1e-19	37	90	3	56
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ eq+++Le+ Fe+++++ e++ +LAk+l+L+ rqV vWFqNrRa++k Spipo15G0017300 37 KKRRLSVEQVKALERNFEEENKLEPEKKVQLAKELDLQPRQVAVWFQNRRARWK 90 456899***********************************************9 PP
2	HD-ZIP_I/II	124.3	5.5e-40	36	125	1	90
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 ekkrrls eqvk+LE++Feee+kLepe+Kv+la+eL+lqprqvavWFqnrRAR+ktkqlE+dy+ Lk+ y++l+ + e+L+ ++++L +e Spipo15G0017300 36 EKKRRLSVEQVKALERNFEEENKLEPEKKVQLAKELDLQPRQVAVWFQNRRARWKTKQLERDYALLKSDYESLQLSLEALRVDNRALLAE 125 69**********************************************************************************999765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.0E-20	22	93	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.84E-20	24	94	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.767	32	92	IPR001356	Homeobox domain
SMART	SM00389	3.5E-17	35	96	IPR001356	Homeobox domain
CDD	cd00086	3.03E-16	37	93	No hit	No description
Pfam	PF00046	1.1E-16	37	90	IPR001356	Homeobox domain
PROSITE pattern	PS00027	0	67	90	IPR017970	Homeobox, conserved site
Pfam	PF02183	5.7E-11	92	126	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 129 aa Download sequence Send to blast
MIGAGDDEDY GQDLCRGDVA GSGTGDGDSS AGARGEKKRR LSVEQVKALE RNFEEENKLE 60 PEKKVQLAKE LDLQPRQVAV WFQNRRARWK TKQLERDYAL LKSDYESLQL SLEALRVDNR 120 ALLAEART*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	84	92	RRARWKTKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269\|PubMed:10732669, ECO:0000269\|PubMed:18049796}.
UniProt	Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269\|PubMed:10732669, ECO:0000269\|PubMed:18049796}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00271	DAP	Transfer from AT2G22430	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269\|PubMed:17999151, ECO:0000269\|PubMed:18049796}.
UniProt	INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269\|PubMed:17999151, ECO:0000269\|PubMed:18049796}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016740762.1	1e-43	PREDICTED: homeobox-leucine zipper protein ATHB-6-like
Swissprot	Q6K498	3e-41	HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
Swissprot	Q9XH37	3e-41	HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBL	A0A1D1XW46	4e-49	A0A1D1XW46_9ARAE; Homeobox-leucine zipper protein ATHB-16
STRING	Gorai.003G041500.1	1e-42	(Gossypium raimondii)
STRING	evm.model.supercontig_55.70	2e-42	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3009	34	82

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22430.1	1e-41	homeobox protein 6

Link Out ? help Back to Top
Phytozome	Spipo15G0017300

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]