 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Spipo15G0002000 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
Family |
bHLH |
Protein Properties |
Length: 88aa MW: 9681.94 Da PI: 8.5057 |
Description |
bHLH family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Spipo15G0002000 | genome | MIPS/IBIS | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | HLH | 27.4 | 5.9e-09 | 14 | 55 | 14 | 55 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
d+i++ ++L++llP+a + +s++ s a L++++ YIksLq
Spipo15G0002000 14 DDIKELVAKLQSLLPEARRRSSGRTSAAKLLKETCSYIKSLQ 55
6899999*********88***********************9 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea (By similarity). {ECO:0000250}. |
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. {ECO:0000269|PubMed:23136524}. |