 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Sp_155320_exug.t2 |
| Common Name | SOVF_155320 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
| Family |
HB-other |
| Protein Properties |
Length: 120aa MW: 13680.5 Da PI: 7.4521 |
| Description |
HB-other family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Sp_155320_exug.t2 | genome | TBVR | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 24.8 | 3.8e-08 | 51 | 82 | 24 | 55 |
S--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 24 ypsaeereeLAkklgLterqVkvWFqNrRake 55
+++++e+ LA+ +gL+++q+ +WF N+R ++
Sp_155320_exug.t2 51 KLKESEKVALAEATGLDQKQINNWFINQRKRH 82
67789999*********************985 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0001708 | Biological Process | cell fate specification |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0010051 | Biological Process | xylem and phloem pattern formation |
| GO:0010089 | Biological Process | xylem development |
| GO:0005634 | Cellular Component | nucleus |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2). |
| Publications
? help Back to Top |
- dela Paz JS, et al.
Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events.
PLoS Genet., 2012. 8(12): p. e1003136
[PMID:23284301] - Liu C, et al.
Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis.
J Integr Plant Biol, 2013. 55(8): p. 682-95
[PMID:23931744] - Liu B, et al.
NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana.
J. Exp. Bot., 2013. 64(17): p. 5345-57
[PMID:23963677] - Simonini S,Kater MM
Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
J. Exp. Bot., 2014. 65(6): p. 1455-65
[PMID:24482368] - Scofield S,Dewitte W,Murray JA
STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
Plant Signal Behav, 2018.
[PMID:24776954] - Lee JE,Lampugnani ER,Bacic A,Golz JF
SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
Plant J., 2014. 80(1): p. 122-35
[PMID:25060324] - Rast-Somssich MI, et al.
Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
Genes Dev., 2015. 29(22): p. 2391-404
[PMID:26588991] - Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B
Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering.
Gene, 2016. 587(2): p. 120-31
[PMID:27154816] - Li Z, et al.
Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
J Integr Plant Biol, 2016. 58(12): p. 959-970
[PMID:27273574] - Lozano-Sotomayor P, et al.
Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
Plant J., 2016. 88(3): p. 437-451
[PMID:27402171] - Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA
Nonreciprocal complementation of KNOX gene function in land plants.
New Phytol., 2017. 216(2): p. 591-604
[PMID:27886385] - Woerlen N, et al.
Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root.
Planta, 2017. 245(6): p. 1079-1090
[PMID:28204875] - Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD
A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels.
PLoS ONE, 2017. 12(5): p. e0177045
[PMID:28493925] - Wang X, et al.
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
Sci China Life Sci, 2018. 61(1): p. 79-87
[PMID:28887625] - Simonini S,Stephenson P,Østergaard L
A molecular framework controlling style morphology in Brassicaceae.
Development, 2018.
[PMID:29440299] - Felipo-Benavent A, et al.
Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
Development, 2019.
[PMID:30389856]
|
