PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopim12g008800.0.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 189aa MW: 20637 Da PI: 10.0395 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.5 | 9.5e-16 | 118 | 162 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++++ ++lG+g+W+ I+r + ++Rt+ q+ s+ qky Sopim12g008800.0.1 118 PWTEEEHRRFLNGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 162 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.398 | 111 | 167 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.29E-18 | 113 | 168 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.7E-20 | 114 | 166 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.1E-12 | 115 | 162 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-11 | 115 | 165 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.46E-10 | 118 | 163 | No hit | No description |
Pfam | PF00249 | 6.8E-13 | 118 | 162 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MGRKCSHCGY IGHNSRTCST LKSAISGSNF NGGLRLFGVQ LDISNSCFSS HNNNNNNNLK 60 KSFSLDCLSL TNSHLLLLSS SSSPSLNENS STNSIDNNGY LSDGTLVGCV GERKKGVPWT 120 EEEHRRFLNG LEKLGKGDWR GISRNFVTTR TPTQVASHAQ KYFLRQSSLN KKKDVQVSSI 180 WQGATTNM* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975524 | 0.0 | HG975524.1 Solanum lycopersicum chromosome ch12, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004251664.1 | 1e-135 | transcription factor MYBS3 | ||||
Swissprot | Q7XC57 | 4e-48 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A3Q7JRY2 | 1e-134 | A0A3Q7JRY2_SOLLC; Uncharacterized protein | ||||
STRING | Solyc12g008800.1.1 | 1e-134 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3385 | 21 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56840.1 | 1e-42 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|