![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopim10g081840.0.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 155aa MW: 17993.6 Da PI: 10.9266 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 80.7 | 2.5e-25 | 58 | 112 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 p++VNaKQy++Il+RR+ Rak e++ l k rkp+lh SRh hA+rRpRg gGrF Sopim10g081840.0.1 58 TPIFVNAKQYHGILRRRKFRAKEIEKN-L-LKPRKPFLHLSRHLHAKRRPRGGGGRF 112 7********************977745.4.5*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.7E-26 | 55 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 28.778 | 56 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.6E-21 | 59 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.4E-19 | 59 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.4E-19 | 89 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MYINTGIYFR VILSMEQPMS FDSQSYNMDY QGHFDLGLFG QPLGRIMLPL NFTSHDETPI 60 FVNAKQYHGI LRRRKFRAKE IEKNLLKPRK PFLHLSRHLH AKRRPRGGGG RFLNTRKTDG 120 SINNDANGTT KTSNKKCHHT RSQNSEVLQW CIQF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 7e-15 | 57 | 125 | 2 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
4g91_A | 7e-15 | 57 | 115 | 2 | 62 | HAPB protein |
4g92_A | 7e-15 | 57 | 115 | 2 | 62 | HAPB protein |
Search in ModeBase |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254763 | 1e-105 | AC254763.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone slm-63a14 map 10, complete sequence. | |||
GenBank | HG975522 | 1e-105 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019071719.1 | 1e-109 | nuclear transcription factor Y subunit A-10-like isoform X1 | ||||
TrEMBL | A0A3Q7IMA9 | 2e-93 | A0A3Q7IMA9_SOLLC; Uncharacterized protein | ||||
STRING | Solyc10g081840.1.1 | 1e-112 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3706 | 23 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06510.3 | 2e-28 | nuclear factor Y, subunit A10 |