PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopim09g074760.0.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 139aa MW: 15747.7 Da PI: 5.3109 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.7 | 9.4e-55 | 20 | 115 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +e+d+flPianv+rimk++lP+nakisk+ ket+qecvsefisfvtseas+kc++ekrkt+ngdd++wa+++lGf+dyvepl+ yl++yre Sopim09g074760.0.1 20 KEHDKFLPIANVGRIMKHILPQNAKISKEGKETMQECVSEFISFVTSEASEKCHKEKRKTLNGDDICWAMGNLGFDDYVEPLNRYLHRYRE 110 799**************************************************************************************** PP NF-YB 93 legek 97 legek Sopim09g074760.0.1 111 LEGEK 115 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.4E-51 | 15 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.1E-38 | 23 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.6E-27 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.0E-18 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.0E-18 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 1.0E-18 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MVDTNNILGS FDSSEEGGFK EHDKFLPIAN VGRIMKHILP QNAKISKEGK ETMQECVSEF 60 ISFVTSEASE KCHKEKRKTL NGDDICWAMG NLGFDDYVEP LNRYLHRYRE LEGEKANQNK 120 VDIGNKNEES LLGRFYGP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-44 | 18 | 110 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-44 | 18 | 110 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975521 | 0.0 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004247445.1 | 1e-100 | nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 9e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A3Q7I769 | 1e-98 | A0A3Q7I769_SOLLC; Uncharacterized protein | ||||
STRING | Solyc09g074760.1.1 | 2e-99 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-58 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|