PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopim07g053810.0.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 148aa MW: 16864.8 Da PI: 10.3929 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.5 | 3.3e-42 | 43 | 118 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C++dls+ak+yh+rhkvCe h+k++vv+v+gl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++ Sopim07g053810.0.1 43 CQAEKCNVDLSDAKQYHKRHKVCEYHAKSQVVVVAGLRQRFCQQCSRFHELTEFDESKRSCRRRLAGHNERRRKST 118 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.2E-33 | 37 | 104 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.052 | 40 | 117 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.09E-38 | 42 | 120 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.8E-32 | 43 | 116 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MEKNDDLLVI STSENTNKKI ITTNNNKKLL SNSSSSSSLI RSCQAEKCNV DLSDAKQYHK 60 RHKVCEYHAK SQVVVVAGLR QRFCQQCSRF HELTEFDESK RSCRRRLAGH NERRRKSTSS 120 SSSSSSSADR IHISIQENPT HKNFHLR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-38 | 33 | 116 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975519 | 1e-147 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004243367.2 | 1e-102 | squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 3e-41 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A3Q7HEQ9 | 1e-101 | A0A3Q7HEQ9_SOLLC; Uncharacterized protein | ||||
STRING | Solyc07g053810.2.1 | 1e-102 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 8e-39 | squamosa promoter binding protein-like 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|