PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g032190.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 96aa    MW: 10702.1 Da    PI: 4.8431
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g032190.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB75.76.9e-242780255
               NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcq 55
                        reqdrf Pianv+r m+k+lP naki+++++ ++qecvsefisfvt+ea++++ 
  Sopim02g032190.0.1 27 REQDRFTPIANVVRNMRKILPPNAKIADESQLVIQECVSEFISFVTGEANNHAS 80
                        89************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.2E-212380IPR009072Histone-fold
SuperFamilySSF471134.66E-142982IPR009072Histone-fold
PfamPF008082.3E-123480IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MERSMELPSH LNKEIVANEE DLECTIREQD RFTPIANVVR NMRKILPPNA KIADESQLVI  60
QECVSEFISF VTGEANNHAS LSSTRQSPLK TCFGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A7e-232576556NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2467521e-160AC246752.2 Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-46o2 map 2, complete sequence.
GenBankHG9755141e-160HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006356442.27e-44PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
RefseqXP_015168332.11e-43PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
RefseqXP_015168333.11e-43PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
RefseqXP_015168334.17e-44PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
SwissprotQ84W664e-24NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A3Q7EX302e-63A0A3Q7EX30_SOLLC; Uncharacterized protein
STRINGSolyc02g032190.1.13e-64(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2669422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-26nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  2. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  3. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  4. Li D, et al.
    MYB89 Transcription Factor Represses Seed Oil Accumulation.
    Plant Physiol., 2017. 173(2): p. 1211-1225
    [PMID:27932421]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  6. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]