PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopim01g067130.0.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 139aa MW: 15010.6 Da PI: 5.9617 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 168.2 | 9.8e-53 | 22 | 117 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+easdkc++e+rkt+ngdd++wal+tlGf+dy +lk yl++yre Sopim01g067130.0.1 22 REQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTGEASDKCRKERRKTVNGDDICWALGTLGFDDYSGALKRYLHRYRE 112 89***************************************************************************************** PP NF-YB 93 legek 97 egek Sopim01g067130.0.1 113 SEGEK 117 **997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-49 | 18 | 123 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.23E-37 | 24 | 122 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-26 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-15 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 1.4E-15 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 1.4E-15 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MSQQNIGGAS SSNDEGAAGS SREQDRLLPI ANVGRIMKNI LPPNAKISKE AKETMQECVS 60 EFIGFVTGEA SDKCRKERRK TVNGDDICWA LGTLGFDDYS GALKRYLHRY RESEGEKVNQ 120 EQAGGGASGS NQPRNLLD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-43 | 22 | 112 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-43 | 22 | 112 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975513 | 0.0 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019068761.1 | 6e-99 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 2e-60 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A3Q7EG93 | 1e-97 | A0A3Q7EG93_SOLLC; Uncharacterized protein | ||||
STRING | Solyc01g067130.2.1 | 2e-98 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 9e-63 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|