![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen11g007490.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 194aa MW: 21814.7 Da PI: 4.4945 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 166.8 | 2.7e-52 | 46 | 139 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 reqdrf+Pianv+rim+++lP +akis+d+k+t+qecvsefisfvt+ea+++cq e+rkti+++dllwa+++lGf+dy+epl+ yl++yre++ Sopen11g007490.1 46 REQDRFMPIANVMRIMRRILPPHAKISDDSKQTIQECVSEFISFVTGEANERCQCEQRKTITAEDLLWAMSKLGFDDYIEPLTFYLHRYREID 138 89*****************************************************************************************98 PP NF-YB 95 g 95 g Sopen11g007490.1 139 G 139 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.1E-48 | 39 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.67E-37 | 48 | 145 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.5E-25 | 51 | 115 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.0E-16 | 79 | 97 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 82 | 98 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.0E-16 | 98 | 116 | No hit | No description |
PRINTS | PR00615 | 7.0E-16 | 117 | 135 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MDNNVGGLGN GGFHGYHTFP STPATEMRMG VPVPVHLNQD SECTIREQDR FMPIANVMRI 60 MRRILPPHAK ISDDSKQTIQ ECVSEFISFV TGEANERCQC EQRKTITAED LLWAMSKLGF 120 DDYIEPLTFY LHRYREIDGG EHGALTEESA MLKLDPQYAG YFVYPLPMAN TTCMQGDGIT 180 SQCAVESDDS LFLC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 8e-60 | 41 | 136 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975450 | 0.0 | HG975450.1 Solanum pennellii chromosome ch11, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015058120.1 | 1e-146 | nuclear transcription factor Y subunit B-6 isoform X1 | ||||
Swissprot | Q84W66 | 2e-64 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A3Q7IT82 | 1e-108 | A0A3Q7IT82_SOLLC; Uncharacterized protein | ||||
STRING | Solyc11g012750.1.1 | 2e-93 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 9e-64 | nuclear factor Y, subunit B6 |