![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen07g014330.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 117aa MW: 13744.8 Da PI: 10.773 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.9 | 3.1e-15 | 16 | 59 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT+eE+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky Sopen07g014330.1 16 WTEEEHRRFLMGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKY 59 *******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.765 | 8 | 64 | IPR017930 | Myb domain |
SMART | SM00717 | 4.2E-9 | 12 | 62 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 7.1E-18 | 14 | 62 | IPR006447 | Myb domain, plants |
SuperFamily | SSF46689 | 1.12E-16 | 15 | 64 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.9E-12 | 16 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.52E-8 | 16 | 60 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.0E-11 | 16 | 59 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MWVPVAARFW VVTVGWTEEE HRRFLMGLEK LGKGDWRGIS RKFVTTRTPT QVASHAQKYF 60 LRHSTHLNKK KRRSSLFDME RRKNKMEESK GDYGNPTSPI SEEIALATKD TLIWSSY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 68 | 72 | KKKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975446 | 1e-130 | HG975446.1 Solanum pennellii chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004242968.1 | 1e-70 | transcription factor MYBS3-like | ||||
Swissprot | Q7XC57 | 3e-31 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | M1AKK6 | 2e-61 | M1AKK6_SOLTU; Uncharacterized protein | ||||
STRING | Solyc07g026680.2.1 | 3e-42 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3385 | 21 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56840.1 | 7e-34 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|