PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopen03g028400.2

Organism

Solanum pennellii

Taxonomic ID

28526

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

NAC

Protein Properties

Length: 163aa MW: 18865.8 Da PI: 10.3928

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopen03g028400.2	genome	spenn	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	143.8	9.4e-45	14	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF+Ptdee+v +yL +k+ + +l++ ++i+e++i+k +Pw+Lp v e++ yfFs+++ ky++g+r+nrat gyWk +g dk+++ Sopen03g028400.2 14 LPPGFRFQPTDEEIVFQYLIRKTFSCPLPA-SIIPEINICKNDPWNLPGDV---EQDRYFFSNKEAKYRNGNRANRATIGGYWKPSGLDKQII 102 79**************************.89***********554...5689*****************************99 PP NAM 94 sk.kgelvglkktLvfykg.rapkgektdWvmheyrl 128 ++ ++ +g+kktLvfykg +a+++ +tdW+mheyrl Sopen03g028400.2 103 CSkRKPIIGMKKTLVFYKGkSASQAYRTDWIMHEYRL 139 97455569*****995678889*******98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.41E-47	10	145	IPR003441	NAC domain
PROSITE profile	PS51005	46.387	14	163	IPR003441	NAC domain
Pfam	PF02365	2.9E-24	15	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MDKFNFVKDG AIKLPPGFRF QPTDEEIVFQ YLIRKTFSCP LPASIIPEIN ICKNDPWNLP 60 GDVEQDRYFF SNKEAKYRNG NRANRATIGG YWKPSGLDKQ IICSKRKPII GMKKTLVFYK 120 GKSASQAYRT DWIMHEYRLV LPKNSSSNLH VHFNKSSSQQ AKK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-37	12	160	15	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-37	12	160	15	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-37	12	160	15	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-37	12	160	15	171	NO APICAL MERISTEM PROTEIN
3swm_A	2e-37	12	160	18	174	NAC domain-containing protein 19
3swm_B	2e-37	12	160	18	174	NAC domain-containing protein 19
3swm_C	2e-37	12	160	18	174	NAC domain-containing protein 19
3swm_D	2e-37	12	160	18	174	NAC domain-containing protein 19
3swp_A	2e-37	12	160	18	174	NAC domain-containing protein 19
3swp_B	2e-37	12	160	18	174	NAC domain-containing protein 19
3swp_C	2e-37	12	160	18	174	NAC domain-containing protein 19
3swp_D	2e-37	12	160	18	174	NAC domain-containing protein 19
4dul_A	1e-37	12	160	15	171	NAC domain-containing protein 19
4dul_B	1e-37	12	160	15	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975442	1e-167	HG975442.1 Solanum pennellii chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015069739.1	1e-118	NAC domain-containing protein 83
Swissprot	Q9FY93	4e-64	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A3Q7GCT8	1e-116	A0A3Q7GCT8_SOLLC; Uncharacterized protein
STRING	Solyc03g097650.2.1	1e-117	(Solanum lycopersicum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	2e-66	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]