![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen01g050640.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 128aa MW: 14210.3 Da PI: 8.0394 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 43.3 | 5e-14 | 7 | 41 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C +Cg ++T+lWR+g+ ++ LCnaCG ++r +++ Sopen01g050640.2 7 CFHCGIKQTILWRNGSPEKPVLCNACGSRWRGRRT 41 ****************88888**********9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 9.5E-8 | 1 | 55 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 7.13E-10 | 4 | 42 | No hit | No description |
CDD | cd00202 | 2.62E-11 | 6 | 41 | No hit | No description |
PROSITE profile | PS50114 | 9.117 | 7 | 33 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.6E-10 | 7 | 39 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 3.0E-11 | 7 | 41 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 7 | 32 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MGKTGPCFHC GIKQTILWRN GSPEKPVLCN ACGSRWRGRR TLDGYIPRHG NIEIENYQLP 60 YDMKPAREGK KLEVGIEVSG QDGSSACLEE EMNNISSLCL AGSSSENCMQ MEETNVSAKL 120 LISKKNMR |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-171 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015082630.1 | 6e-70 | GATA transcription factor 26-like | ||||
TrEMBL | A0A3Q7FD25 | 6e-63 | A0A3Q7FD25_SOLLC; Uncharacterized protein | ||||
STRING | PGSC0003DMT400061125 | 7e-43 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17570.3 | 1e-22 | GATA transcription factor 26 |