![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc10g081840.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 155aa MW: 18023.7 Da PI: 10.9266 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 79 | 8.9e-25 | 58 | 112 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 p++VNaKQy++Il+RR+ R k e++ l k rkp+lh SRh hA+rRpRg gGrF Solyc10g081840.1.1 58 TPIFVNAKQYHGILRRRKFRTKEIEKN-L-LKPRKPFLHLSRHLHAKRRPRGGGGRF 112 7*******************9976644.5.6*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.7E-25 | 55 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 28.031 | 56 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 5.7E-21 | 59 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.4E-18 | 59 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.4E-18 | 89 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MYINTGIYFR VILSMEQPMS FDSQSYNMDY QGHFDLGLFG QPLGRIMLPL NFTSHDETPI 60 FVNAKQYHGI LRRRKFRTKE IEKNLLKPRK PFLHLSRHLH AKRRPRGGGG RFLNTRKTDG 120 SINNDANGTT KTSNKKCHHT RSQNSEVLQW CIQF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_A | 6e-15 | 57 | 115 | 2 | 62 | HAPB protein |
4g92_A | 6e-15 | 57 | 115 | 2 | 62 | HAPB protein |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc10g081840.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC245817 | 5e-08 | Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-126l2 map 1, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019071719.1 | 1e-110 | nuclear transcription factor Y subunit A-10-like isoform X1 | ||||
TrEMBL | A0A3Q7IMA9 | 4e-94 | A0A3Q7IMA9_SOLLC; Uncharacterized protein | ||||
STRING | Solyc10g081840.1.1 | 1e-113 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3706 | 23 | 47 | Representative plant | OGRP5136 | 11 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06510.3 | 7e-28 | nuclear factor Y, subunit A10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc10g081840.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|