PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 284aa MW: 32667.2 Da PI: 9.318

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc08g082890.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.8	7.8e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+t Ed+ll ++++q+G g+W++ ++ g+ R++k+c++rw +yl Solyc08g082890.2.1 14 KGPWSTKEDLLLTNYINQYGEGQWRSLPKNAGLLRCGKSCRLRWVNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	55.2	1.6e-17	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++E++l+v+++ +lG++ W++Ia +++ gRt++++k++w+++l Solyc08g082890.2.1 67 RGNFSEDEEDLIVRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.9E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.959	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	8.24E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	4.7E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	8.1E-14	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.25E-8	16	61	No hit	No description
PROSITE profile	PS51294	25.623	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-25	65	116	IPR009057	Homeodomain-like
SMART	SM00717	2.3E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	4.9E-16	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	7.49E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 284 aa Download sequence Send to blast
MGRAPCCAKE GLRKGPWSTK EDLLLTNYIN QYGEGQWRSL PKNAGLLRCG KSCRLRWVNY 60 LKPGIKRGNF SEDEEDLIVR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLTKKLRSTG 120 IEPKPHKNLT KLKEKSRKQT KKEKSRKEVG KKSNDEKLKG QIAQVEKIKV FAPKPIRISC 180 GISRNNSFEN DTLSTTTCSS NSNFEKVDDG KDREKEVKLF PRELDFDELL EGGGFYDEFL 240 MGESCNFSNK VEMNDNMVEK VYEEYLLLLS EIQEDQTEQK FSM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-25	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in anthers (PubMed:24319076, PubMed:25053018). Expressed in pollen grains and mature seeds (PubMed:25053018). Expressed in roots and vasculature of leaves (PubMed:24319076). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc08g082890.2.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP009299	0.0	Solanum lycopersicum genomic DNA, chromosome 8, clone: C08SLm0006K11, complete sequence

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004246088.1	0.0	transcription factor MYB7
Swissprot	Q42379	4e-65	MYB7_ARATH; Transcription factor MYB7
TrEMBL	A0A3Q7HV65	0.0	A0A3Q7HV65_SOLLC; Uncharacterized protein
STRING	Solyc08g082890.2.1	0.0	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09460.1	2e-65	myb domain protein 6

Link Out ? help Back to Top
Phytozome	Solyc08g082890.2.1
Entrez Gene	101251314

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jia X, et al. Small tandem target mimic-mediated blockage of microRNA858 induces anthocyanin accumulation in tomato. Planta, 2015. 242(1): p. 283-93 [PMID:25916310] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]