PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc08g022080.2.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 142aa MW: 15916 Da PI: 8.5086 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43.6 | 6.2e-14 | 2 | 51 | 10 | 59 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 + +NRe+ArrsR+RK+a + eLe+ v + eN++L k+l +++++ + Solyc08g022080.2.1 2 MLSNRESARRSRRRKQAHLTELETQVSQVRVENSSLLKRLTDISQKYNEA 51 679***********************************999999988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50217 | 9.622 | 1 | 50 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.17E-10 | 2 | 47 | No hit | No description |
SMART | SM00338 | 3.2E-9 | 2 | 57 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.5E-10 | 2 | 49 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.8E-9 | 3 | 49 | No hit | No description |
Pfam | PF12498 | 3.7E-23 | 64 | 121 | IPR020983 | Basic leucine-zipper, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MMLSNRESAR RSRRRKQAHL TELETQVSQV RVENSSLLKR LTDISQKYNE AAVDNRVLKA 60 DVETLRAKVK MAEETVKRVT GLNPLFQAMS EISTVMMPSF TSSPFDSSAD AAVPEHDDLN 120 YPAPENGHMP NHDCRMQNAR G* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 9 | 16 | RRSRRRKQ |
2 | 11 | 16 | SRRRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.3298 | 0.0 | callus| cell culture| floral bud| flower| fruit| leaf| seed| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc08g022080.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT014428 | 0.0 | Lycopersicon esculentum clone 133746F, mRNA sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010324786.1 | 2e-98 | light-inducible protein CPRF2 isoform X2 | ||||
Swissprot | Q99090 | 2e-52 | CPRF2_PETCR; Light-inducible protein CPRF2 | ||||
TrEMBL | A0A3Q7HJU3 | 8e-94 | A0A3Q7HJU3_SOLLC; Uncharacterized protein | ||||
STRING | Solyc08g022080.2.1 | 1e-101 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2934 | 24 | 44 | Representative plant | OGRP1839 | 16 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28770.1 | 3e-40 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc08g022080.2.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|