PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 217aa MW: 25672.6 Da PI: 7.7313

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc07g054960.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.4	5.2e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed +l ++++G ++W+ +++ g+ R++k+c++rw +yl Solyc07g054960.1.1 14 RGAWSEDEDNKLRAFIQKFGHPNWRQLPKYAGLMRCGKSCRLRWMNYL 61 89********************************************97 PP
2	Myb_DNA-binding	55.3	1.5e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ + eE++l+++++++lG++ W+ Ia++++ gR+++++k++w+ + Solyc07g054960.1.1 67 KGNYSHEEEQLIIKLHNKLGNR-WSEIAAKLP-GRSDNDVKNHWHAH 111 7899****************.*****.*********976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.934	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.16E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.3E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-14	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-21	15	68	IPR009057	Homeodomain-like
CDD	cd00167	6.66E-10	16	61	No hit	No description
PROSITE profile	PS51294	24.925	62	116	IPR017930	Myb domain
SMART	SM00717	4.3E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.0E-16	67	111	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.6E-25	69	115	IPR009057	Homeodomain-like
CDD	cd00167	1.54E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 217 aa Download sequence Send to blast
MVRTPFIDKN GIKRGAWSED EDNKLRAFIQ KFGHPNWRQL PKYAGLMRCG KSCRLRWMNY 60 LRPGLKKGNY SHEEEQLIIK LHNKLGNRWS EIAAKLPGRS DNDVKNHWHA HLKKRPRLTN 120 TYSSTSEQFT ESSQFDSQNH DQQSYEDGYN LSNTINGMDW IEENNNHIKT MEQLSSINNT 180 LVEQSLPNNF QIETFDFNFW SEPLFDDFWT QSFFFQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-26	14	115	7	107	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269\|PubMed:19122102}.
Uniprot	TISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269\|PubMed:19122102, ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269\|PubMed:19122102}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc07g054960.1.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269\|PubMed:19122102, ECO:0000269\|PubMed:22197883, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC244804	2e-08	Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-74b18 map 10, complete sequence
GenBank	L41253	2e-08	Lycopersicon esculentum Hsc70 (Hsc70) gene, complete cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015160634.1	1e-140	PREDICTED: myb-related protein Myb4-like
Swissprot	Q9SA47	4e-54	MYB58_ARATH; Transcription factor MYB58
TrEMBL	A0A3Q7HD52	1e-161	A0A3Q7HD52_SOLLC; Uncharacterized protein
STRING	Solyc07g054960.1.1	1e-162	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79180.1	2e-55	myb domain protein 63

Link Out ? help Back to Top
Phytozome	Solyc07g054960.1.1
Entrez Gene	101257982

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana. J. Plant Physiol., 2015. 175: p. 86-94 [PMID:25506770] Noda S, et al. The expression of a rice secondary wall-specific cellulose synthase gene, OsCesA7, is directly regulated by a rice transcription factor, OsMYB58/63. Planta, 2015. 242(3): p. 589-600 [PMID:26070439] Takeuchi M,Kegasa T,Watanabe A,Tamura M,Tsutsumi Y Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation. J. Plant Res., 2018. 131(2): p. 297-305 [PMID:28921082]