![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc06g069310.2.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 132aa MW: 14678.4 Da PI: 4.2503 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 57.2 | 4e-18 | 2 | 67 | 21 | 86 |
NF-YB 21 lPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al lGf +y+e++ + Solyc06g069310.2.1 2 LPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREEKRTIAPEHVLKALQVLGFGEYIEEVYAA 67 8999*********************************************************98654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.4E-30 | 2 | 112 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.04E-26 | 3 | 113 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.5E-14 | 4 | 52 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MLPPDVRVAR DTQDLLIECC VEFINLISSE SNEVCNREEK RTIAPEHVLK ALQVLGFGEY 60 IEEVYAAYEQ HKLETMDTVR AGKCSNGAEM TEEEALAEQQ RMFAEARARM NGGVTGPPKQ 120 QDSEAEQTLN S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 6e-30 | 4 | 107 | 30 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.21373 | 0.0 | fruit| leaf| stem |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc06g069310.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004241619.1 | 9e-94 | protein Dr1 homolog | ||||
Refseq | XP_006354739.1 | 9e-94 | PREDICTED: protein Dr1 homolog | ||||
Refseq | XP_015077062.1 | 9e-94 | protein Dr1 homolog | ||||
Swissprot | P49592 | 6e-70 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A0A3Q7H0N5 | 2e-92 | A0A3Q7H0N5_SOLLC; Uncharacterized protein | ||||
TrEMBL | M0ZY19 | 2e-92 | M0ZY19_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400010436 | 4e-93 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3820 | 22 | 44 | Representative plant | OGRP3449 | 17 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.4 | 4e-74 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc06g069310.2.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|