PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 230aa MW: 27331.1 Da PI: 9.4921

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc05g053150.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.9	2.3e-18	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd+ll+d+v+++G g+W+ +ar g++R +k+c++rw +yl Solyc05g053150.1.1 13 KGPWTVEEDKLLIDYVNLHGEGRWNCVARLAGLKRNGKSCRLRWVNYL 60 79********************************************97 PP
2	Myb_DNA-binding	48.8	1.6e-15	66	110	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg T+ E+ +++++++ +G++ W+tIar ++ gRt++++k++w+++ Solyc05g053150.1.1 66 RGQITPYEERIILELHAIWGNR-WSTIARNLP-GRTDNEIKNYWRTH 110 6788999*************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.308	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	6.47E-30	11	107	IPR009057	Homeodomain-like
SMART	SM00717	8.6E-15	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-16	13	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.4E-23	14	67	IPR009057	Homeodomain-like
CDD	cd00167	5.09E-10	15	60	No hit	No description
PROSITE profile	PS51294	24.931	61	115	IPR017930	Myb domain
SMART	SM00717	5.3E-14	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-13	66	110	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.7E-24	68	116	IPR009057	Homeodomain-like
CDD	cd00167	3.16E-9	70	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 230 aa Download sequence Send to blast
MRRWGIIEEE WRKGPWTVEE DKLLIDYVNL HGEGRWNCVA RLAGLKRNGK SCRLRWVNYL 60 RPDLKRGQIT PYEERIILEL HAIWGNRWST IARNLPGRTD NEIKNYWRTH FKKKVKKTST 120 DNSEKTKRIC LLKRHQFQQQ QLSNSQIDLK RMMLLFEENE NKVVSHVPKQ DMTILYHNNT 180 FHEQDQQGGL FGSMINGYAN YVQVPEASSN EDIMWDIGLW NLDDYNVNL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-27	13	115	7	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269\|PubMed:22301384}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc05g053150.1.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF426174	3e-07	Lycopersicon esculentum blind mRNA, complete cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004240221.1	1e-171	transcription factor MYB24-like
Swissprot	Q10MB4	1e-52	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A3Q7GLT8	1e-170	A0A3Q7GLT8_SOLLC; Uncharacterized protein
STRING	Solyc05g053150.1.1	1e-170	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24310.1	3e-77	myb domain protein 305

Link Out ? help Back to Top
Phytozome	Solyc05g053150.1.1
Entrez Gene	101248880

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]