PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 219aa MW: 25595.1 Da PI: 6.8698

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc05g014290.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	41.3	3.5e-13	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd +l + + G +W+++++ g+ R++k+c++rw +yl Solyc05g014290.2.1 14 RGPWTIEEDHKLMNFILNNGIQCWRLVPKLAGLMRCGKSCRLRWINYL 61 89********************************************97 PP
2	Myb_DNA-binding	53	7.7e-17	67	110	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+ E++ +++++ qlG++ W++Ia +++ gRt++++k++w++ Solyc05g014290.2.1 67 RGALTEAEEDMIIKLHSQLGNR-WSKIAGHFP-GRTDNEIKNHWNT 110 7889****************.*****.*********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.8E-21	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.004	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.61E-28	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.7E-5	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-11	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.16E-4	16	61	No hit	No description
PROSITE profile	PS51294	27.027	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-25	65	117	IPR009057	Homeodomain-like
SMART	SM00717	4.7E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-14	67	110	IPR001005	SANT/Myb domain
CDD	cd00167	2.03E-10	71	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 219 aa Download sequence Send to blast
MGRQPCCDKI GLKRGPWTIE EDHKLMNFIL NNGIQCWRLV PKLAGLMRCG KSCRLRWINY 60 LRPDLKRGAL TEAEEDMIIK LHSQLGNRWS KIAGHFPGRT DNEIKNHWNT RIKKKLKFLG 120 IDPLTHKPIE EINNDDIKQQ VSEEINEKVM PEKTLEYTQE QQNSTSSSSI NESNNLEMFQ 180 NSHTLDMYYP GFEDPLQNWI TSPIHNWDLF DNLQDNFL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-29	12	116	5	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.23844	0.0	leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in chalaza of mature seeds, cotyledons, rosette leaves, cauline leaves, veins of stems, mature siliques, sepals and styles. Expressed at low levels in roots. {ECO:0000269\|PubMed:23660402}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269\|PubMed:23660402}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00510	DAP	Transfer from AT5G14340	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc05g014290.2.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269\|PubMed:23660402}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	X99210	5e-18	L.esculentum mRNA for myb-related transcription factor, THM16

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004239173.1	1e-163	transcription factor MYB20
Swissprot	Q9C7U7	1e-75	MYB20_ARATH; Transcription factor MYB20
TrEMBL	A0A3Q7GHU1	1e-161	A0A3Q7GHU1_SOLLC; Uncharacterized protein
STRING	Solyc05g014290.2.1	1e-162	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14340.1	8e-85	myb domain protein 40

Link Out ? help Back to Top
Phytozome	Solyc05g014290.2.1
Entrez Gene	101256283

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]