PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 179aa MW: 20660.7 Da PI: 9.6558

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc05g008250.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.2	1.6e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++++G g+W+ ++ g+ R++k+c++rw +yl Solyc05g008250.1.1 14 KGAWSKQEDQKLIDYITKHGEGCWRNLPKAAGLLRCGKSCRLRWMNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	57.5	3e-18	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l Solyc05g008250.1.1 67 RGNFSEDEDDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 112 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.361	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.34E-29	12	108	IPR009057	Homeodomain-like
SMART	SM00717	5.7E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-15	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.8E-23	15	68	IPR009057	Homeodomain-like
CDD	cd00167	3.19E-10	16	61	No hit	No description
PROSITE profile	PS51294	27.062	62	116	IPR017930	Myb domain
SMART	SM00717	5.4E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	7.6E-17	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	5.96E-12	69	112	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.0E-27	69	117	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
MRKPCCDNKE EMHKGAWSKQ EDQKLIDYIT KHGEGCWRNL PKAAGLLRCG KSCRLRWMNY 60 LNPNLKRGNF SEDEDDLIIK LHALLGNRWS LIAGRLPGRT DNEVKNYWNS HLTRKLIKMG 120 IDPKNHRLSH YLHIKRLELL QENNTRLENV GVISDATSSY ANKDQQITSS LLDLNLIP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-31	11	116	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. {ECO:0000269\|PubMed:9839469}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc05g008250.1.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004239398.1	1e-129	transcription factor MYB3
Swissprot	Q9S9K9	1e-70	MYB3_ARATH; Transcription factor MYB3
TrEMBL	K4BWZ9	1e-128	K4BWZ9_SOLLC; MYB-like transcriptional factor MYB76
STRING	Solyc05g008250.1.1	1e-129	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	5e-73	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Solyc05g008250.1.1
Entrez Gene	101264519

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]