PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB_related

Protein Properties

Length: 191aa MW: 22223.8 Da PI: 10.152

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc04g050000.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.4	6.9e-18	64	106	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +++T eEd +++a+++lG++ W++Iar ++ gRt++ +k++w++ Solyc04g050000.1.1 64 QPFTFEEDNTIIRAHAKLGNR-WAKIARLLP-GRTDNAIKNHWNS 106 79*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	5.761	6	57	IPR017877	Myb-like domain
SMART	SM00717	0.057	10	59	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.7E-11	13	65	IPR009057	Homeodomain-like
SuperFamily	SSF46689	4.51E-21	37	114	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.641	58	112	IPR017930	Myb domain
SMART	SM00717	4.3E-16	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-16	64	106	IPR001005	SANT/Myb domain
CDD	cd00167	1.16E-12	65	108	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.6E-23	66	111	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 191 aa Download sequence Send to blast
MEKLKKTRMI KRQWNPKEEE LLHKLVKELG AENLSLIVQL MSSQYEKSCR FHRLKQLNPQ 60 VDHQPFTFEE DNTIIRAHAK LGNRWAKIAR LLPGRTDNAI KNHWNSSLKR KHHSMLEDLT 120 LESPQPPLKK SLSIGEGQNL GIPYRSELSN FGFDRFPPFC LYLHIAPFGR ILPFSICTYN 180 NRSICIFESI *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-28	9	111	2	104	MYB PROTO-ONCOGENE PROTEIN
1mse_C	3e-28	9	111	2	104	C-Myb DNA-Binding Domain
1msf_C	3e-28	9	111	2	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc04g050000.1.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CU468294	0.0	S.lycopersicum DNA sequence from clone LE_HBa-6D20 on chromosome 4, complete sequence

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010319954.1	1e-111	transcription factor MYB73-like
Swissprot	O23160	4e-36	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A3Q7GVT1	1e-110	A0A3Q7GVT1_SOLLC; Uncharacterized protein
STRING	Solyc04g050000.1.1	1e-139	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA18535	3	4
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37260.1	6e-32	myb domain protein 73

Link Out ? help Back to Top
Phytozome	Solyc04g050000.1.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]