|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Solyc04g025050.1.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
Family |
M-type_MADS |
Protein Properties |
Length: 57aa MW: 6259.52 Da PI: 11.0693 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Solyc04g025050.1.1 | genome | ITAG | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 62.2 | 5.9e-20 | 2 | 47 | 4 | 49 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
+n++n vtfsk r g++KKA+ L+ LC+ae+++++fs++gk++ +
Solyc04g025050.1.1 2 KNTRNLRVTFSKHRVGLFKKASKLCMLCGAEISIVVFSPNGKVFSF 47
799****************************************988 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. |
Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Publications
? help Back to Top |
- Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] - Xu W, et al.
Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] - Figueiredo DD,Batista RA,Roszak PJ,Köhler C
Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] - Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] - Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] - Zhang S, et al.
FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]
|