![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc04g005100.2.1 | ||||||||
Common Name | LOC101257759 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 270aa MW: 29699.5 Da PI: 10.5687 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.1 | 2.3e-14 | 88 | 132 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky Solyc04g005100.2.1 88 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 132 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.836 | 81 | 137 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.11E-17 | 83 | 137 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.4E-17 | 84 | 135 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.8E-10 | 85 | 135 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-11 | 87 | 132 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-11 | 88 | 132 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.21E-9 | 88 | 133 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0031540 | Biological Process | regulation of anthocyanin biosynthetic process | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 270 aa Download sequence Send to blast |
MSNNEFFIQS GNKEHEPQTY VKGFMLFGVR MMEGAAATGG SFRKSASMNN LALLDMEQQH 60 QDHSNTGYAS DDVVHPSARS RERKRGVPWT EEEHKLFLLG LQKVGKGDWR GISRNFVKTR 120 TPTQVASHAQ KYFLRRNNNN RRRRRSSLFD ITTDTVQGAA KLEDNKQMND CRMSVFRLES 180 PVKLPVTGES SSEIGMNKSM KPIRPIPALP VPPSSKMADL NLNLSTSALV TVAGNENSPS 240 PPRHSTAFQP AMSGGFNGST SGDSIISVA* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.6954 | 0.0 | flower| fruit| leaf| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00630 | PBM | Transfer from PK17526.1 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc04g005100.2.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004237073.1 | 0.0 | transcription factor MYB1R1 | ||||
Swissprot | Q9LVS0 | 8e-48 | KUA1_ARATH; Transcription factor KUA1 | ||||
TrEMBL | A0A3Q7FY70 | 0.0 | A0A3Q7FY70_SOLLC; Uncharacterized protein | ||||
STRING | Solyc04g005100.2.1 | 0.0 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11423 | 22 | 25 | Representative plant | OGRP394 | 16 | 99 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G70000.2 | 1e-59 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc04g005100.2.1 |
Entrez Gene | 101257759 |
Publications ? help Back to Top | |||
---|---|---|---|
|