PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 254aa MW: 29035.2 Da PI: 9.2342

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc03g093890.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	44.8	3e-14	20	67	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l ++ ++G +W+ ++ g+ Rt+k+c++rw +yl Solyc03g093890.2.1 20 KGAWSPEEDQKLRGYIMKYGIWNWRQMPKFAGLSRTGKSCRLRWMNYL 67 79****************99**********************97 PP
2	Myb_DNA-binding	46.2	1e-14	73	118	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++TteE e+ ++ ++lG+ W++Ia++++ gRt++++k++++++l Solyc03g093890.2.1 73 RGPFTTEEVEIVIKTYQELGNS-WSAIAAKLP-GRTDNEVKNFFHTHL 118 89****************99.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.521	15	67	IPR017930	Myb domain
SMART	SM00717	1.7E-11	19	69	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.39E-28	19	114	IPR009057	Homeodomain-like
Pfam	PF00249	7.7E-13	20	67	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-22	21	74	IPR009057	Homeodomain-like
CDD	cd00167	1.44E-9	22	67	No hit	No description
PROSITE profile	PS51294	21.685	68	122	IPR017930	Myb domain
SMART	SM00717	3.2E-13	72	120	IPR001005	SANT/Myb domain
Pfam	PF00249	9.9E-13	73	118	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.7E-24	75	122	IPR009057	Homeodomain-like
CDD	cd00167	4.18E-9	75	118	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 254 aa Download sequence Send to blast
MPRVQQQQQK GTSMEAIIKK GAWSPEEDQK LRGYIMKYGI WNWRQMPKFA GLSRTGKSCR 60 LRWMNYLRPD VKRGPFTTEE VEIVIKTYQE LGNSWSAIAA KLPGRTDNEV KNFFHTHLKK 120 HLGLKNHDVP LKTRKIRKQT KEDEKKISTR GRLVLETSNN SNLLTTDVCS PCSSITTCEE 180 NQMMDPFVNF SQTFEVCYNN ITSLVVDQQV PGMEHTCINI GVAQPHSIPH GPAVNSFDQF 240 DMNSFWIDVL GNI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-23	4	120	11	126	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.23151	0.0	cell culture

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc03g093890.2.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC246582	2e-08	Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-26i13 map 1, complete sequence
GenBank	AC246642	2e-08	Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-41f18 map 1, complete sequence
GenBank	GQ911580	2e-08	Solanum lycopersicum hexose transporter 1 (HT1) mRNA, complete cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001333764.1	0.0	R2R3MYB transcription factor 52
Swissprot	Q9LTC4	2e-46	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A3Q7FLR4	0.0	A0A3Q7FLR4_SOLLC; Uncharacterized protein
STRING	Solyc03g093890.2.1	0.0	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	8e-49	myb domain protein 15

Link Out ? help Back to Top
Phytozome	Solyc03g093890.2.1
Entrez Gene	101245233

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]