Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Sly&pid=Solyc02g077560.2.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | B3 | 76.7 | 2.5e-24 | 160 | 261 | 1 | 99 |
EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
B3 1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84
f+k+lt sd++++g +++p++ ae++ + ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F +
Solyc02g077560.2.1 160 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyrQ--QRPSQELVAKDLHGIEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 248
99****************************9743..345679************************************************4 PP
-SSSEE..EEEEE-S CS
B3 85 dgrsefelvvkvfrk 99
+ ++el+++v+r+
Solyc02g077560.2.1 249 --TGDGELRLGVRRA 261
..4788899999986 PP
|
2 | Auxin_resp | 117.3 | 1.3e-38 | 286 | 367 | 1 | 82 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82
a++ +s++++F+++YnPr s+s+F+v+++k++k+l +++s+GmRfkm++eted++e+r++G+vvgvs++dpvrWp+SkWr+L
Solyc02g077560.2.1 286 AVNVISSRNAFNICYNPRDSSSDFIVPYHKFSKTLAHPFSAGMRFKMRVETEDAAEQRFTGLVVGVSNVDPVRWPGSKWRCL 367
68999****************************************************************************9 PP
|
Publications
? help Back to Top |
- Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] - Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors. Mol. Gen. Mikrobiol. Virusol., 2013. [PMID:24003511] - Thoma R,Chandler JW
Polarity in the early floral meristem of Arabidopsis. Plant Signal Behav, 2015. 10(4): p. e992733 [PMID:25806573] - Lora J,Hormaza JI,Herrero M
Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT). New Phytol., 2015. 208(2): p. 584-95 [PMID:25991552] - Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] - Zhang X, et al.
Auxin Response Gene SlARF3 Plays Multiple Roles in Tomato Development and is Involved in the Formation of Epidermal Cells and Trichomes. Plant Cell Physiol., 2015. 56(11): p. 2110-24 [PMID:26412778] - Cabrera J, et al.
Differentially expressed small RNAs in Arabidopsis galls formed by Meloidogyne javanica: a functional role for miR390 and its TAS3-derived tasiRNAs. New Phytol., 2016. 209(4): p. 1625-40 [PMID:26542733] - Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity. Plant Cell, 2015. 27(12): p. 3321-35 [PMID:26589551] - Yamaguchi N,Wu MF,Winter CM,Wagner D
LEAFY and Polar Auxin Transport Coordinately Regulate Arabidopsis Flower Development. Plants (Basel), 2014. 3(2): p. 251-65 [PMID:27135503] - Matsumura Y, et al.
A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] - Simonini S, et al.
A noncanonical auxin-sensing mechanism is required for organ morphogenesis in Arabidopsis. Genes Dev., 2016. 30(20): p. 2286-2296 [PMID:27898393] - Pfannebecker KC,Lange M,Rupp O,Becker A
An Evolutionary Framework for Carpel Developmental Control Genes. Mol. Biol. Evol., 2017. 34(2): p. 330-348 [PMID:28049761] - Wójcikowska B,Gaj MD
Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787] - Su Z, et al.
The THO Complex Non-Cell-Autonomously Represses Female Germline Specification through the TAS3-ARF3 Module. Curr. Biol., 2017. 27(11): p. 1597-1609.e2 [PMID:28552357] - Simonini S,Bencivenga S,Trick M,Østergaard L
Auxin-Induced Modulation of ETTIN Activity Orchestrates Gene Expression in Arabidopsis. Plant Cell, 2017. 29(8): p. 1864-1882 [PMID:28804059] - Guan C, et al.
Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086] - Simonini S, et al.
Corrigendum: A noncanonical auxin-sensing mechanism is required for organ morphogenesis in Arabidopsis. Genes Dev., 2017. 31(17): p. 1821 [PMID:28982764] - Zhang K, et al.
AUXIN RESPONSE FACTOR3 Regulates Floral Meristem Determinacy by Repressing Cytokinin Biosynthesis and Signaling. Plant Cell, 2018. 30(2): p. 324-346 [PMID:29371438] - Vial-Pradel S, et al.
Arabidopsis Zinc-Finger-Like Protein ASYMMETRIC LEAVES2 (AS2) and Two Nucleolar Proteins Maintain Gene Body DNA Methylation in the Leaf Polarity Gene ETTIN (ARF3). Plant Cell Physiol., 2018. 59(7): p. 1385-1397 [PMID:29415182] - Simonini S,Stephenson P,Østergaard L
A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299] - Andres-Robin A, et al.
Evidence for the Regulation of Gynoecium Morphogenesis by ETTIN via Cell Wall Dynamics. Plant Physiol., 2018. 178(3): p. 1222-1232 [PMID:30237208] - Hablak SG
Features inheritance of root system Arabidopsis thaliana (L.) Heynh. the interaction of genes CTR1 AND ALF3, NPH4 and IAR2. Tsitol. Genet., 2019. [PMID:30484609]
|