![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc02g065800.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 143aa MW: 16204.5 Da PI: 9.6825 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 98.4 | 1.3e-30 | 43 | 111 | 2 | 70 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 g+kdrhsk+ T +g+RdRRvRls+++a +++dLqd+LG+d++sk ++WLl++ak+ i+el+ ++ ++ Solyc02g065800.1.1 43 FGGKDRHSKVLTVKGLRDRRVRLSVPTALQVYDLQDKLGLDQPSKVVDWLLNEAKHDIDELPPLQIRDQ 111 689***********************************************************9955444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 29.99 | 45 | 103 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 2.4E-29 | 45 | 130 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MISREVDPSD NNVIMIPKKS SLSSSSSWTR FKDPRIVRVS RAFGGKDRHS KVLTVKGLRD 60 RRVRLSVPTA LQVYDLQDKL GLDQPSKVVD WLLNEAKHDI DELPPLQIRD QTGLPLTGLR 120 KEEEETMVVS DEDRVKLDVR NT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 1e-19 | 50 | 104 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 1e-19 | 50 | 104 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc02g065800.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC246813 | 0.0 | Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-33h20 map 2, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004253504.3 | 5e-97 | transcription factor TCP17-like | ||||
Swissprot | Q9S7W5 | 2e-40 | TCP13_ARATH; Transcription factor TCP13 | ||||
TrEMBL | A0A494GA56 | 1e-95 | A0A494GA56_SOLLC; Uncharacterized protein | ||||
STRING | Solyc02g065800.1.1 | 4e-97 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA821 | 24 | 99 | Representative plant | OGRP180 | 15 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G02150.1 | 7e-43 | plastid transcription factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc02g065800.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|