PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc01g099320.2.1

Common Name

LOC101267361

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

NF-YB

Protein Properties

Length: 147aa MW: 16727.8 Da PI: 4.9004

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc01g099320.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	147.8	2.2e-46	4	96	3	95
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 e+ +++Pianv+rimk++lP akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf++y+e + yl k r++e+ Solyc01g099320.2.1 4 EHVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFER 96 566899*************************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.6E-43	6	120	IPR009072	Histone-fold
SuperFamily	SSF47113	5.37E-34	9	117	IPR009072	Histone-fold
Pfam	PF00808	3.8E-26	9	72	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.3E-17	36	54	No hit	No description
PROSITE pattern	PS00685	0	39	55	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	5.3E-17	55	73	No hit	No description
PRINTS	PR00615	5.3E-17	74	92	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
MVDEHVKLVP IANVGRIMKQ ILPPTAKISK EAKETMQECA SEFISFVTGE ASDKCHKENR 60 RTVNGDDICW ALSSLGFDNY AEVMLRYLYK LRDFERVRAN QNKLGLNDDD NTDDDDDDGE 120 ARRASTTSLA PLEINVMERV QRRRFN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	8e-37	2	93	1	92	Transcription factor HapC (Eurofung)
4g92_B	8e-37	2	93	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc01g099320.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC193777	0.0	Solanum lycopersicum chromosome 1 clone C01HBa0051C14, complete sequence

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004231278.1	1e-106	nuclear transcription factor Y subunit B-4-like
Swissprot	O04027	2e-49	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A2G2W7T3	3e-80	A0A2G2W7T3_CAPBA; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A3Q7END4	2e-80	A0A3Q7END4_SOLLC; Uncharacterized protein
STRING	Solyc01g099320.2.1	1e-105	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	7e-51	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	Solyc01g099320.2.1
Entrez Gene	101267361

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]