![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof016032 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 191aa MW: 21276.8 Da PI: 10.3726 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 108 | 1.1e-33 | 2 | 77 | 54 | 129 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +ekewyfF+++d+ky+tg r+nrat+sgyWkatgkdke+++ ++ lvg+kktLvfy+grap+g kt Wvmheyrle Sof016032 2 GEKEWYFFCHKDRKYPTGMRTNRATASGYWKATGKDKEIFRGHRVLVGMKKTLVFYTGRAPRGGKTPWVMHEYRLE 77 579**************************************99999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 40.014 | 1 | 100 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 6.8E-38 | 2 | 100 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-16 | 6 | 76 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MGEKEWYFFC HKDRKYPTGM RTNRATASGY WKATGKDKEI FRGHRVLVGM KKTLVFYTGR 60 APRGGKTPWV MHEYRLEGSL PSNLRRGAKD EWAVCKVFNK DLAAKAGQMA PLHAVGGGME 120 RSDSLAFLDD LVLDNADLPP LIDSPYADAG LIVDYNKSAV GGASNFLVRR GGHERKGXVT 180 KSSRERRATT X |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-31 | 1 | 105 | 68 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-31 | 1 | 105 | 68 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-31 | 1 | 105 | 68 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-31 | 1 | 105 | 68 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-31 | 1 | 105 | 71 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-31 | 1 | 105 | 68 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-31 | 1 | 105 | 68 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002461233.1 | 1e-106 | NAC domain-containing protein 79 | ||||
Swissprot | Q9FK44 | 1e-55 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
TrEMBL | A0A097C0P6 | 1e-109 | A0A097C0P6_9POAL; NAC11 | ||||
STRING | Sb02g043270.1 | 1e-106 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.1 | 5e-58 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|