PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof005302
Organism
Saccharum officinarum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MIKC_MADS
Protein Properties Length: 160aa    MW: 18682.2 Da    PI: 10.3696
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17336015PU_unrefUnigeneView CDS
PUT-157a-Saccharum_officinarum-102612PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF101.14e-32959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  Sof005302  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSS 59
               79***********************************************96 PP
2K-box85.41.2e-2884159883
      K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                + e+++ +s+++e+ kLk++++nLqr+qR+llGedLesL +keL++Le+qL++slk+iRs++++++++q+ elqk+
  Sof005302  84 NRENEQLKSSRNEYLKLKARVDNLQRTQRNLLGEDLESLGIKELEHLEKQLDSSLKHIRSTRTQHMVDQLTELQKR 159
                4678899*******************************************************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.641161IPR002100Transcription factor, MADS-box
CDDcd002655.40E-42274No hitNo description
SuperFamilySSF554556.67E-34289IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014864.3E-2186159IPR002487Transcription factor, K-box
PROSITE profilePS5129713.14690160IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFSST  60
QSMPKTLEKY QKCSFAGPET ALQNRENEQL KSSRNEYLKL KARVDNLQRT QRNLLGEDLE  120
SLGIKELEHL EKQLDSSLKH IRSTRTQHMV DQLTELQKRX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-2575159186Developmental protein SEPALLATA 3
4ox0_B3e-2575159186Developmental protein SEPALLATA 3
4ox0_C3e-2575159186Developmental protein SEPALLATA 3
4ox0_D3e-2575159186Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.121270.0inflorescence| seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) primordia and later in stamen and pistil primordia. Expressed during ovule development in the inner and outer integuments. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695}.
UniprotTISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695, ECO:0000269|PubMed:9339904}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.10}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445814.11e-111MADS-box transcription factor 7
SwissprotP0C5B01e-102MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-102MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLC5YHS61e-109C5YHS6_SORBI; Uncharacterized protein
STRINGSb07g026200.11e-110(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.13e-80MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Shitsukawa N, et al.
    Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat.
    Plant Cell, 2007. 19(6): p. 1723-37
    [PMID:17586655]
  3. Bai X,Wang Q,Chu C
    Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter.
    Transgenic Res., 2008. 17(6): p. 1035-43
    [PMID:18437520]
  4. Qu L, et al.
    Expression pattern and functional analysis of a MADS-box gene M79 from rice.
    Sci. China, C, Life Sci., 2001. 44(2): p. 161-9
    [PMID:18726433]
  5. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]
  6. Li H, et al.
    The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
    Cell Res., 2010. 20(3): p. 299-313
    [PMID:20038961]
  7. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  8. Tang X, et al.
    Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis.
    Plant Physiol., 2010. 154(4): p. 1855-70
    [PMID:20959420]
  9. Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
    High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
    Theor. Appl. Genet., 2011. 122(8): p. 1489-96
    [PMID:21327937]
  10. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  11. Yoshida H
    Is the lodicule a petal: molecular evidence?
    Plant Sci., 2012. 184: p. 121-8
    [PMID:22284716]
  12. Duan Y, et al.
    Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(4-5): p. 429-42
    [PMID:22933119]
  13. Wong CE,Singh MB,Bhalla PL
    Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean.
    BMC Plant Biol., 2013. 13: p. 105
    [PMID:23870482]
  14. Hu Z,Ding X,Hu S,Sun Y,Xia L
    Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice.
    Biotechnol. Lett., 2013. 35(12): p. 2177-83
    [PMID:23974493]
  15. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]
  16. Dreni L,Zhang D
    Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes.
    J. Exp. Bot., 2016. 67(6): p. 1625-38
    [PMID:26956504]