![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.005G019800.1.p | ||||||||
Common Name | Sb05g001690, SORBIDRAFT_05g001690 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 99aa MW: 10139 Da PI: 7.0016 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 101.2 | 7.3e-32 | 25 | 79 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 v+Y+eC++NhAas+GghavDGC+Efm+s g+egtaaa+ CaACgCHR+FHRreve Sobic.005G019800.1.p 25 VVHYRECQRNHAASIGGHAVDGCREFMAS-GAEGTAAAMACAACGCHRSFHRREVE 79 799*************************9.999********************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 2.4E-30 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 2.8E-26 | 27 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 5.0E-10 | 28 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.399 | 28 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MGPQQDRSSS MANGTAAARS KEAKVVHYRE CQRNHAASIG GHAVDGCREF MASGAEGTAA 60 AMACAACGCH RSFHRREVEA GGDDDRDCSS TSTSTTSG* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.005G019800.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ726979 | 1e-64 | KJ726979.1 Zea mays clone pUT3680 ZF-HD transcription factor (ZHD10) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002448925.1 | 1e-64 | mini zinc finger protein 1 | ||||
Swissprot | B8BIU8 | 2e-33 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
Swissprot | Q2RB28 | 2e-33 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
TrEMBL | C5Y3N8 | 2e-63 | C5Y3N8_SORBI; Uncharacterized protein | ||||
STRING | Sb05g001690.1 | 4e-64 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Representative plant | OGRP91 | 16 | 237 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 4e-14 | mini zinc finger 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.005G019800.1.p |
Entrez Gene | 8083047 |
Publications ? help Back to Top | |||
---|---|---|---|
|