PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sobic.003G223400.1.p

Common Name

Sb03g028170, SORBIDRAFT_03g028170

Organism

Sorghum bicolor

Taxonomic ID

4558

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum

Family

MYB_related

Protein Properties

Length: 79aa MW: 8989.91 Da PI: 6.8074

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sobic.003G223400.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	27.9	5.5e-09	33	72	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T+ E++l + +++ G++ W+ Ia +++ gRt++++ +w Sobic.003G223400.1.p 33 FTEAEEDLVSRMHRLVGNR-WEIIAGRIP-GRTAEEVEMFWS 72 9****************.*****.*****99986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	7.0E-7	29	77	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.5E-8	32	73	IPR009057	Homeodomain-like
CDD	cd00167	1.93E-6	33	71	No hit	No description
PROSITE profile	PS50090	6.504	33	75	IPR017877	Myb-like domain
Pfam	PF00249	5.5E-8	33	72	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.0E-11	33	73	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010026	Biological Process	trichome differentiation
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048765	Biological Process	root hair cell differentiation
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MDSSSGSQDK KSKGNDRREA KEANGTAQHF VDFTEAEEDL VSRMHRLVGN RWEIIAGRIP 60 GRTAEEVEMF WSKKHQER*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in leaves primordia and later confined to trichomes. {ECO:0000269\|PubMed:12356720}.
Uniprot	TISSUE SPECIFICITY: Expressed in trichomes and in young developing leaves, as well as in root hair and stele cells (pericycle and vascular tissues). Expressed in epidermal root hairless cells (atrichoblasts) and moves to root hair cells (trichoblasts) by a cell-to-cell movement through plasmodesmata (at protein level). {ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16291794}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:12356720, ECO:0000269\|PubMed:16291794, ECO:0000269\|PubMed:19513241, ECO:0000269\|PubMed:9262483}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Sobic.003G223400.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16176989, ECO:0000269\|PubMed:16207757, ECO:0000269\|PubMed:17450124, ECO:0000269\|PubMed:19513241}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU973098	1e-101	EU973098.1 Zea mays clone 393226 hypothetical protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002458170.1	1e-51	MYB-like transcription factor ETC3
Swissprot	O22059	3e-17	CPC_ARATH; Transcription factor CPC
TrEMBL	C5XR42	3e-50	C5XR42_SORBI; Uncharacterized protein
STRING	Sb03g028170.1	5e-51	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5275	31	57
Representative plant	OGRP3921	8	25

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G01060.1	7e-20	CAPRICE-like MYB3

Link Out ? help Back to Top
Phytozome	Sobic.003G223400.1.p
Entrez Gene	8084840

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Tominaga-Wada R,Wada T The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Kurata T,Wada T Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] Tominaga-Wada R,Kurata T,Wada T Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Tominaga-Wada R,Wada T Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]