![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_17498.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 171aa MW: 19013.7 Da PI: 6.1372 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 122.7 | 1.6e-38 | 1 | 89 | 8 | 96 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +P +nv+rim+k+lP + ki +++k +qec+ efisfvtsea+d+cq+e+ kti+++dllwa+ +lGf+dyve+l ++l++y e++g Sme2.5_17498.1_g00002.1 1 MPTSNVVRIMRKILPPQVKIFDKSKVAIQECIIEFISFVTSEANDHCQQEQCKTITAQDLLWAMDKLGFDDYVETLALFLHRYCEFDG 88 799**********************************************************************************987 PP NF-YB 96 e 96 + Sme2.5_17498.1_g00002.1 89 H 89 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 1.3E-18 | 1 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.61E-28 | 1 | 87 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 3.4E-34 | 1 | 86 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 2.9E-11 | 28 | 46 | No hit | No description |
PRINTS | PR00615 | 2.9E-11 | 47 | 65 | No hit | No description |
PRINTS | PR00615 | 2.9E-11 | 66 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MPTSNVVRIM RKILPPQVKI FDKSKVAIQE CIIEFISFVT SEANDHCQQE QCKTITAQDL 60 LWAMDKLGFD DYVETLALFL HRYCEFDGHG SLKGEYLVSK RPMVDSASGC NIMPYHLPPN 120 FPMAHHHGYF GFPATMTKCM QANTSNGSTS KSAVTAVDSE VDSPAKEGTS D |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-38 | 1 | 85 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006356442.2 | 2e-72 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Refseq | XP_015168332.1 | 2e-72 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_015168333.1 | 2e-72 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_015168334.1 | 2e-72 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Swissprot | Q84W66 | 6e-39 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A1S3YW85 | 6e-69 | A0A1S3YW85_TOBAC; nuclear transcription factor Y subunit B-4-like | ||||
STRING | XP_009611476.1 | 2e-69 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 1e-41 | nuclear factor Y, subunit B6 |