![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_09185.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 189aa MW: 21340.4 Da PI: 7.9938 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 146.3 | 7e-46 | 34 | 128 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 reqd ++P anv+rim+k+lP +akis+++k +qec+sefisfvt+ea+d+cq+e+rkti+++dll a+ +lGf+dyvepl+ +l Sme2.5_09185.1_g00001.1 34 REQDYYIPTANVVRIMRKILPPQAKISDESKVAIQECISEFISFVTGEANDRCQQEQRKTITAEDLLGAMEKLGFDDYVEPLTFFL 119 89************************************************************************************ PP NF-YB 88 kkyrelege 96 ++y ++eg Sme2.5_09185.1_g00001.1 120 HRYHQFEGR 128 *****9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.6E-43 | 28 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.12E-34 | 36 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.6E-23 | 40 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.4E-13 | 67 | 85 | No hit | No description |
PRINTS | PR00615 | 5.4E-13 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 5.4E-13 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MLFFKSATRI NRGLPAHLNQ AIAVTARDSK CAIREQDYYI PTANVVRIMR KILPPQAKIS 60 DESKVAIQEC ISEFISFVTG EANDRCQQEQ RKTITAEDLL GAMEKLGFDD YVEPLTFFLH 120 RYHQFEGRGS LKGEPLVLKR PMADSASSYN IMPCHLPPNF LMAHHHGYFV FPPTVTKYIQ 180 ADTSNGSSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-48 | 29 | 124 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006356442.2 | 5e-90 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Refseq | XP_015168332.1 | 2e-89 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_015168333.1 | 2e-89 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_015168334.1 | 5e-90 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Swissprot | Q84W66 | 1e-50 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A3Q7J7C7 | 6e-83 | A0A3Q7J7C7_SOLLC; Uncharacterized protein | ||||
STRING | Solyc10g009440.2.1 | 3e-83 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 2e-53 | nuclear factor Y, subunit B6 |