PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_03284.1_g00004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 143aa MW: 16626.7 Da PI: 4.6053 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 145.4 | 1.3e-45 | 4 | 96 | 3 | 95 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 e+ +++Pianv+rim+++lP akisk+ake +qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf++y+e + yl k Sme2.5_03284.1_g00004.1 4 EHVKLVPIANVGRIMRQILPPTAKISKEAKERMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEVMVRYLYKL 91 566899********************************************************************************** PP NF-YB 91 releg 95 r++e+ Sme2.5_03284.1_g00004.1 92 RDFER 96 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-43 | 6 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.2E-25 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 2.17E-34 | 9 | 123 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 4.7E-17 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-17 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 4.7E-17 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MVDEHVKLVP IANVGRIMRQ ILPPTAKISK EAKERMQECA SEFISFVTGE ASDKCHKENR 60 RTVNGDDICW ALSSLGFDNY AEVMVRYLYK LRDFERLRAN QDKVGSNDQD EHNTDDEEAP 120 NEKQETVVPL LEFDIMERMQ RFD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-36 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-36 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC193777 | 1e-124 | AC193777.1 Solanum lycopersicum chromosome 1 clone C01HBa0051C14, complete sequence. | |||
GenBank | HG975440 | 1e-124 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
GenBank | HG975513 | 1e-124 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015087711.1 | 6e-75 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 2e-47 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2G2W7T3 | 5e-76 | A0A2G2W7T3_CAPBA; Nuclear transcription factor Y subunit B-4 | ||||
STRING | Solyc01g099320.2.1 | 5e-73 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 8e-50 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|