PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NF-YC

Protein Properties

Length: 105aa MW: 11757.8 Da PI: 10.6243

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_02949.1_g00006.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	27.8	5.2e-09	16	93	19	96
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdiv 96 ++P+ ri + lka+ k + +Pv+l a e++++++ + + a++nk++ ++ i+ av + d + l+ +v Sme2.5_02949.1_g00006.1 16 LQFPVGRITRFLKAERYAKYVVVGTPVFLVAALEYLVVKVLEVAGNTARDNKKTQINPRHIQLAVRNDDELNKLLRDV 93 589**************************************************************9998776554333 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00414	1.9E-32	2	105	IPR002119	Histone H2A
Gene3D	G3DSA:1.10.20.10	7.4E-43	4	104	IPR009072	Histone-fold
Pfam	PF00125	4.6E-11	5	81	IPR007125	Histone H2A/H2B/H3
SuperFamily	SSF47113	9.63E-32	5	90	IPR009072	Histone-fold
PRINTS	PR00620	6.5E-31	6	28	IPR002119	Histone H2A
PRINTS	PR00620	6.5E-31	35	50	IPR002119	Histone H2A
PRINTS	PR00620	6.5E-31	50	63	IPR002119	Histone H2A
PRINTS	PR00620	6.5E-31	64	78	IPR002119	Histone H2A
PRINTS	PR00620	6.5E-31	92	105	IPR002119	Histone H2A

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000786	Cellular Component	nucleosome
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MAVTKKSCSR STKTGLQFPV GRITRFLKAE RYAKYVVVGT PVFLVAALEY LVVKVLEVAG 60 NTARDNKKTQ INPRHIQLAV RNDDELNKLL RDVFINNGEL SPLIS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5gsu_C	1e-37	6	104	13	111	Histone H2A type 1-A
5gsu_G	1e-37	6	104	13	111	Histone H2A type 1-A
5gt0_C	1e-37	6	104	13	111	Histone H2A type 1-A
5gt0_G	1e-37	6	104	13	111	Histone H2A type 1-A
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022028534.1	3e-44	histone H2A.6
Swissprot	O81826	9e-45	H2A3_ARATH; Probable histone H2A.3
TrEMBL	A0A1J3ITE2	6e-43	A0A1J3ITE2_NOCCA; Histone H2A
STRING	Lus10032464	3e-43	(Linum usitatissimum)
STRING	Lus10042960	3e-43	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA164	6	9

Publications ? help Back to Top
Yi H,Sardesai N,Fujinuma T,Chan CW,Gelvin SB Constitutive expression exposes functional redundancy between the Arabidopsis histone H2A gene HTA1 and other H2A gene family members. Plant Cell, 2006. 18(7): p. 1575-89 [PMID:16751347] Sridhar VV, et al. Control of DNA methylation and heterochromatic silencing by histone H2B deubiquitination. Nature, 2007. 447(7145): p. 735-8 [PMID:17554311]