![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_01620.1_g00008.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 114aa MW: 12711.8 Da PI: 8.7287 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 130.6 | 6.5e-41 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 +CaaCk+lrrkC+++Cvlapyfp +qp+kf +vhk+FGa+nv kll+ + +reda++sl+yeAe r+rdPvyG+vg+i+ l+ + Sme2.5_01620.1_g00008.1 7 PCAACKLLRRKCTQECVLAPYFPPDQPQKFSIVHKVFGAKNVGKLLNVFNAAQREDAVNSLAYEAEQRIRDPVYGCVGLISLLEYK 92 7************************************************************************************* PP DUF260 87 leqlkaelallkee 100 l+q++ ++ +k+e Sme2.5_01620.1_g00008.1 93 LKQVQDDMMNAKKE 106 ******99998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.397 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.2E-40 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MSSTISPCAA CKLLRRKCTQ ECVLAPYFPP DQPQKFSIVH KVFGAKNVGK LLNVFNAAQR 60 EDAVNSLAYE AEQRIRDPVY GCVGLISLLE YKLKQVQDDM MNAKKELTAY IGPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-44 | 6 | 110 | 10 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-44 | 6 | 110 | 10 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009792980.1 | 2e-65 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_016501970.1 | 2e-65 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_019264646.1 | 2e-65 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_019264647.1 | 2e-65 | PREDICTED: LOB domain-containing protein 36-like | ||||
Swissprot | Q9FKZ3 | 4e-60 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A0V0GYD0 | 5e-65 | A0A0V0GYD0_SOLCH; Putative ovule protein (Fragment) | ||||
TrEMBL | A0A1S4CLH7 | 5e-64 | A0A1S4CLH7_TOBAC; LOB domain-containing protein 36-like | ||||
TrEMBL | A0A1U7Y2I1 | 5e-64 | A0A1U7Y2I1_NICSY; LOB domain-containing protein 36-like | ||||
TrEMBL | A0A314L3T6 | 4e-64 | A0A314L3T6_NICAT; Lob domain-containing protein 36 | ||||
STRING | XP_009792980.1 | 8e-65 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 2e-62 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|