PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sevir.5G438700.1.p

Organism

Setaria viridis

Taxonomic ID

4556

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria

Family

M-type_MADS

Protein Properties

Length: 167aa MW: 18485.4 Da PI: 9.9518

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sevir.5G438700.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	80	1.6e-25	11	60	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k rqv fskRr g++KKA+EL LCdaeva+++fs+ gklyeyss Sevir.5G438700.1.p 11 RIEDKASRQVRFSKRRSGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 60 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	28.987	2	62	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.2E-32	2	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.16E-38	3	75	No hit	No description
PRINTS	PR00404	3.0E-27	4	24	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.53E-30	4	85	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.7E-25	11	58	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-27	24	39	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-27	39	60	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MARRGRVELR RIEDKASRQV RFSKRRSGLF KKAFELALLC DAEVALLVFS PAGKLYEYSS 60 TSIEGTYERY QRFAGTGRNV NAGDRNNNDS QDAAASDLQT RLKEIATWSE QNNANESDAN 120 ELEKLEKLLT NALRDTTTKK MLTKQNNGGA GGSTSSQNSS GPRRED*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3kov_B	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3kov_I	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3kov_J	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_A	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_B	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_C	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_D	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_I	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
3p57_J	4e-18	4	73	2	71	Myocyte-specific enhancer factor 2A
5f28_A	4e-18	4	73	3	72	MEF2C
5f28_B	4e-18	4	73	3	72	MEF2C
5f28_C	4e-18	4	73	3	72	MEF2C
5f28_D	4e-18	4	73	3	72	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Sevir.5G438700.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004971093.1	1e-117	MADS-box transcription factor 51
Swissprot	Q9XJ61	5e-77	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A2S3HNK5	1e-101	A0A2S3HNK5_9POAL; Uncharacterized protein
STRING	Pavir.J02739.1.p	1e-101	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G22950.1	5e-31	AGAMOUS-like 19

Link Out ? help Back to Top
Phytozome	Sevir.5G438700.1.p

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465]