PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G060600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 417aa    MW: 45237.3 Da    PI: 4.6441
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G060600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-14210267461
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          k+ +rk++NRe+ArrsR RK a ++e e+ v++L+ eN++L  +l +l++++   + 
  Sevir.2G060600.1.p 210 EKVRKRKESNRESARRSRYRKAAHLKEMEDQVAQLKVENSSLLRRLATLNQKYTDATV 267
                         5899**********************************************99876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-20207271IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634209261IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-11209262No hitNo description
PfamPF001703.8E-11210262IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.0E-10211262No hitNo description
CDDcd147023.95E-20213262No hitNo description
PROSITE patternPS000360214229IPR004827Basic-leucine zipper domain
PfamPF124981.6E-13278388IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDDHAVSMEE IIPDPFWEDL PPPPEPHLVT SDGLIDGVVT DGGGEGTNAM DQNQSPSEWS  60
FERLLEEELL TDAAPLENFS GSAPHADTVV EEVDHATMAP AAVSTVGDPM EYNTILKRKL  120
DEDLATVAMW RASSVVHPEH SQGSNNYIGG NINFVQNMRS ISEGPINRAR NAYIRARLAT  180
SSSSRDPSPS DDDDMDGEVE ILGFKLPTEE KVRKRKESNR ESARRSRYRK AAHLKEMEDQ  240
VAQLKVENSS LLRRLATLNQ KYTDATVDNR VLKANMETLR AKVKMAEDAL KRVTGTMSSS  300
QPSRPSPPVP ANADASGPIL DNIIDYLMNS TDATTDNNFE PRTATTPSFS QQAEKPAAAS  360
TNSAMINRIA AHHAVAVELL HKRLGAMPTA SSGVAPPPEP APPSDVLVES TDMGVH*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regulation of the endosperm-specific production of albumin b-32 and other zein proteins. It is a trans-acting transcriptional activator that binds to the consensus sequence 5'-GATGAYRTGR-3'. {ECO:0000269|PubMed:2001677}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G060600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5139851e-139AF513985.1 Pennisetum glaucum opaque-2-like protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955660.10.0regulatory protein opaque-2
SwissprotP129593e-99OP2_MAIZE; Regulatory protein opaque-2
TrEMBLK3ZTP00.0K3ZTP0_SETIT; Uncharacterized protein
STRINGSi029970m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34883878
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.22e-25bZIP family protein
Publications ? help Back to Top
  1. de Souza Filho GA, et al.
    Identification of a DNA-binding factor that recognizes an alpha-coixin promoter and interacts with a Coix Opaque-2 like protein.
    Plant Mol. Biol., 1999. 39(1): p. 95-104
    [PMID:10080712]
  2. Burnett RJ,Larkins BA
    Opaque2 modifiers alter transcription of the 27-kDa gamma-zein genes in maize.
    Mol. Gen. Genet., 1999. 261(6): p. 908-16
    [PMID:10485281]
  3. Gaziola SA,Alessi ES,Guimaraes PE,Damerval C,Azevedo RA
    Quality protein maize: a biochemical study of enzymes involved in lysine metabolism.
    J. Agric. Food Chem., 1999. 47(3): p. 1268-75
    [PMID:10552448]
  4. Ciceri P,Locatelli F,Genga A,Viotti A,Schmidt RJ
    The activity of the maize Opaque2 transcriptional activator is regulated diurnally.
    Plant Physiol., 1999. 121(4): p. 1321-8
    [PMID:10594119]
  5. Ciceri P, et al.
    Specific combinations of zein genes and genetic backgrounds influence the transcription of the heavy-chain zein genes in maize opaque-2 endosperms.
    Plant Physiol., 2000. 124(1): p. 451-60
    [PMID:10982458]
  6. Wang X,Larkins BA
    Genetic analysis of amino acid accumulation in opaque-2 maize endosperm.
    Plant Physiol., 2001. 125(4): p. 1766-77
    [PMID:11299357]
  7. Varagona MJ,Schmidt RJ,Raikhel NV
    Nuclear localization signal(s) required for nuclear targeting of the maize regulatory protein Opaque-2.
    Plant Cell, 1992. 4(10): p. 1213-27
    [PMID:1332794]
  8. Bhat RA,Borst JW,Riehl M,Thompson RD
    Interaction of maize Opaque-2 and the transcriptional co-activators GCN5 and ADA2, in the modulation of transcriptional activity.
    Plant Mol. Biol., 2004. 55(2): p. 239-52
    [PMID:15604678]
  9. Hasjim J,Srichuwong S,Scott MP,Jane JL
    Kernel composition, starch structure, and enzyme digestibility of opaque-2 maize and quality protein maize.
    J. Agric. Food Chem., 2009. 57(5): p. 2049-55
    [PMID:19206469]
  10. Zhang Z,Yang J,Wu Y
    Transcriptional Regulation of Zein Gene Expression in Maize through the Additive and Synergistic Action of opaque2, Prolamine-Box Binding Factor, and O2 Heterodimerizing Proteins.
    Plant Cell, 2015. 27(4): p. 1162-72
    [PMID:25901087]
  11. Morton KJ,Jia S,Zhang C,Holding DR
    Proteomic profiling of maize opaque endosperm mutants reveals selective accumulation of lysine-enriched proteins.
    J. Exp. Bot., 2016. 67(5): p. 1381-96
    [PMID:26712829]
  12. Qiao Z, et al.
    ZmMADS47 Regulates Zein Gene Transcription through Interaction with Opaque2.
    PLoS Genet., 2016. 12(4): p. e1005991
    [PMID:27077660]
  13. Zhou Z, et al.
    Introgression of opaque2 into Waxy Maize Causes Extensive Biochemical and Proteomic Changes in Endosperm.
    PLoS ONE, 2016. 11(7): p. e0158971
    [PMID:27391593]
  14. Yang J,Ji C,Wu Y
    Divergent Transactivation of Maize Storage Protein Zein Genes by the Transcription Factors Opaque2 and OHPs.
    Genetics, 2016. 204(2): p. 581-591
    [PMID:27474726]
  15. Zhang Z,Zheng X,Yang J,Messing J,Wu Y
    Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7
    [PMID:27621432]
  16. Hossain F, et al.
    Marker-assisted introgression of opaque2 allele for rapid conversion of elite hybrids into quality protein maize.
    J. Genet., 2018. 97(1): p. 287-298
    [PMID:29666347]
  17. Gupta HO,Lodha ML,Rastogi DK,Singh J,Mehta SL
    Nutritional evaluation of hard endosperm opaque-2 maize (Zea mays L.).
    J. Agric. Food Chem., 1979 Mar-Apr. 27(2): p. 390-2
    [PMID:429693]
  18. Reddy V,Gupta CP
    Treatment of kwashiorkor with opaque-2 maize.
    Am. J. Clin. Nutr., 1974. 27(2): p. 122-4
    [PMID:4405944]
  19. Quicke GV,Gevers HO
    Higher lysine levels and improved protein quality of opaque-2 maize.
    S. Afr. Med. J., 1972. 46(42): p. 1579-84
    [PMID:4674887]
  20. Pradilla AG,Francis CA,Linares FA
    Studies on protein quality of flint phenotypes of opaque-2 modified maize.
    Arch Latinoam Nutr, 1973. 23(2): p. 217-23
    [PMID:4714788]
  21. Ahuja VP,Srivastava KN,Austin A,Naik MS
    Changes in different protein fractions and their amino acid composition of the endosperm of opaque-2 composite maize, Shakti, during maturation.
    Indian J. Biochem. Biophys., 1973. 10(1): p. 48-50
    [PMID:4778116]
  22. Gupta HO,Lodha ML,Mehta SL,Rastogi DK,Singh J
    Effect of amino acid(s) and pulse supplementation on nutritional quality of normal and modified opaque-2 maize (Zea mays L.).
    J. Agric. Food Chem., 1979 Jul-Aug. 27(4): p. 787-90
    [PMID:512234]
  23. Dalby A,Davies II
    Ribonuclease activity in the developing seeds of normal and opaque-2 maize.
    Science, 1967. 155(3769): p. 1573-5
    [PMID:6020484]
  24. Lee L,Tsai CY
    Zein synthesis in the embryo and endosperm of maize mutants.
    Biochem. Genet., 1984. 22(7-8): p. 729-37
    [PMID:6497834]
  25. Fuwa H,Glover DV,Sugimoto Y,Tanaka M
    Comparative susceptibility to amylases of starch granules of several single endosperm mutants representative of floury-opaque, starch-deficient, and modified starch types and their double-mutant combinations with opaque-2 in four inbred lines of maize.
    J. Nutr. Sci. Vitaminol., 1978. 24(4): p. 437-48
    [PMID:712436]
  26. Tsai CY,Larkins BA,Glover DV
    Interaction of the opaque-2 gene with starch-forming mutant genes on the synthesis of zein in maize endosperm.
    Biochem. Genet., 1978. 16(9-10): p. 883-96
    [PMID:743193]
  27. Michel D, et al.
    Insertion mutations at the maize Opaque2 locus induced by transposable element families Ac, En/Spm and Bg.
    Mol. Gen. Genet., 1995. 248(3): p. 287-92
    [PMID:7565590]
  28. Lopes MA,Takasaki K,Bostwick DE,Helentjaris T,Larkins BA
    Identification of two opaque2 modifier loci in quality protein maize.
    Mol. Gen. Genet., 1995. 247(5): p. 603-13
    [PMID:7603440]
  29. Cord Neto G, et al.
    The involvement of Opaque 2 on beta-prolamin gene regulation in maize and Coix suggests a more general role for this transcriptional activator.
    Plant Mol. Biol., 1995. 27(5): p. 1015-29
    [PMID:7766871]
  30. Dannenhoffer JM,Bostwick DE,Or E,Larkins BA
    opaque-15, a maize mutation with properties of a defective opaque-2 modifier.
    Proc. Natl. Acad. Sci. U.S.A., 1995. 92(6): p. 1931-5
    [PMID:7892202]
  31. Varagona MJ,Raikhel NV
    The basic domain in the bZIP regulatory protein Opaque2 serves two independent functions: DNA binding and nuclear localization.
    Plant J., 1994. 5(2): p. 207-14
    [PMID:8148877]
  32. Michel D,Salamini F,Motto M,Döring HP
    An unstable allele at the maize Opaque2 locus is caused by the insertion of a double Ac element.
    Mol. Gen. Genet., 1994. 243(3): p. 334-42
    [PMID:8190086]
  33. Habben JE,Kirleis AW,Larkins BA
    The origin of lysine-containing proteins in opaque-2 maize endosperm.
    Plant Mol. Biol., 1993. 23(4): p. 825-38
    [PMID:8251635]
  34. Maddaloni M, et al.
    The transcriptional activator Opaque-2 controls the expression of a cytosolic form of pyruvate orthophosphate dikinase-1 in maize endosperms.
    Mol. Gen. Genet., 1996. 250(5): p. 647-54
    [PMID:8676867]
  35. Gallusci P,Varotto S,Matsuoko M,Maddaloni M,Thompson RD
    Regulation of cytosolic pyruvate, orthophosphate dikinase expression in developing maize endosperm.
    Plant Mol. Biol., 1996. 31(1): p. 45-55
    [PMID:8704158]
  36. Pysh LD,Schmidt RJ
    Characterization of the maize OHP1 gene: evidence of gene copy variability among inbreds.
    Gene, 1996. 177(1-2): p. 203-8
    [PMID:8921868]
  37. Rossi V,Motto M,Pellegrini L
    Analysis of the methylation pattern of the maize opaque-2 (O2) promoter and in vitro binding studies indicate that the O2 B-Zip protein and other endosperm factors can bind to methylated target sequences.
    J. Biol. Chem., 1997. 272(21): p. 13758-65
    [PMID:9153230]