PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.8G088600.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 216aa MW: 23993.3 Da PI: 10.9905 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 40.1 | 7.1e-13 | 76 | 111 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 YY+Ct++gC ++kk+ers d +++ei Y+g+ nh Seita.8G088600.1.p 76 DYYKCTFPGCFARKKLERSL-DCQIMEIAYKGRDNHA 111 5*******************.**************96 PP | |||||||
2 | WRKY | 90.6 | 1.2e-28 | 156 | 212 | 2 | 58 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 dDg++WrKYGqK+ kg+++prsY++C++ gCp++k+ver+++d++ +++tYe++Hn Seita.8G088600.1.p 156 DDGCRWRKYGQKVLKGNPNPRSYFKCAMFGCPARKHVERASHDQRSFVTTYESKHNT 212 8******************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 1.0E-4 | 71 | 112 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.24E-7 | 76 | 113 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 5.6E-9 | 76 | 113 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-5 | 77 | 110 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 10.556 | 77 | 113 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.2E-29 | 146 | 212 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.96E-25 | 148 | 212 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.205 | 150 | 215 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.1E-32 | 155 | 214 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.0E-23 | 156 | 211 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MASGGLGERV TGERVAGRGR WMTSWARTGV KGWRQRGGGG RCRSRGKRRP RCIFLFFLLL 60 KLFSSGPQHA AGDGPDYYKC TFPGCFARKK LERSLDCQIM EIAYKGRDNH ARPRNTSRGS 120 AGTAVQVLQS GGGNASERRF GEMPAMSTVS DTEVIDDGCR WRKYGQKVLK GNPNPRSYFK 180 CAMFGCPARK HVERASHDQR SFVTTYESKH NTTTI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-25 | 146 | 211 | 8 | 73 | Probable WRKY transcription factor 4 |
2lex_A | 3e-25 | 146 | 211 | 8 | 73 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.8G088600.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012703602.1 | 1e-108 | WRKY transcription factor WRKY24-like | ||||
Swissprot | Q6B6R4 | 9e-42 | WRK24_ORYSI; WRKY transcription factor WRKY24 | ||||
TrEMBL | A0A368S5R9 | 1e-158 | A0A368S5R9_SETIT; Uncharacterized protein | ||||
STRING | XP_008463823.1 | 2e-42 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP59703 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07100.2 | 5e-43 | WRKY DNA-binding protein 26 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.8G088600.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|