PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria

Family

ZF-HD

Protein Properties

Length: 99aa MW: 10776 Da PI: 7.9267

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Seita.2G204400.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	96.1	2.8e-30	27	85	1	60
ZF-HD_dimer 1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +++vrY eC++NhAas+Gg+a+DGC+Ef+++ geegt alkCaACgCHR+FHRr +++e Seita.2G204400.1.p 27 CCSVRYGECRRNHAASTGGYAIDGCREFIAE-GEEGTGGALKCAACGCHRSFHRRVQVYE 85 5789************************8.999******************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	8.0E-22	11	89	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.1E-29	30	82	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	9.7E-23	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.958	32	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MQRGSSCAES KAWLAGKRCE PIVRFSCCSV RYGECRRNHA ASTGGYAIDG CREFIAEGEE 60 GTGGALKCAA CGCHRSFHRR VQVYEFAWDY GSYTSSTE*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Seita.2G204400.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021309213.1	6e-55	mini zinc finger protein 2-like
Swissprot	Q6ER22	5e-28	MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBL	A0A368Q169	2e-64	A0A368Q169_SETIT; Uncharacterized protein
STRING	Si031576m	5e-54	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	4e-26	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Seita.2G204400.1.p

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]