![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.2188s0030.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 68aa MW: 7862.24 Da PI: 11.3501 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.4 | 1.1e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienks r vtfskRrng++KKA ELSvLCd+++a++ifss++klye+ss SapurV1A.2188s0030.1.p 9 KRIENKSSRLVTFSKRRNGLFKKARELSVLCDVQIALLIFSSRDKLYEFSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 9.3E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-27 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MGRKTVELKR IENKSSRLVT FSKRRNGLFK KARELSVLCD VQIALLIFSS RDKLYEFSSV 60 DRNLIRT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-18 | 1 | 61 | 1 | 61 | MEF2C |
5f28_B | 1e-18 | 1 | 61 | 1 | 61 | MEF2C |
5f28_C | 1e-18 | 1 | 61 | 1 | 61 | MEF2C |
5f28_D | 1e-18 | 1 | 61 | 1 | 61 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269|PubMed:15530395, ECO:0000269|PubMed:25183521, ECO:0000269|PubMed:7632923}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.2188s0030.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024452986.1 | 1e-30 | MADS-box protein FLOWERING LOCUS C | ||||
Refseq | XP_024452987.1 | 1e-30 | MADS-box protein FLOWERING LOCUS C | ||||
Refseq | XP_024452988.1 | 1e-30 | MADS-box protein FLOWERING LOCUS C | ||||
Swissprot | P29383 | 3e-25 | AGL3_ARATH; Agamous-like MADS-box protein AGL3 | ||||
TrEMBL | A0A3N7EWE5 | 1e-31 | A0A3N7EWE5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0003s16840.1 | 3e-32 | (Populus trichocarpa) | ||||
STRING | POPTR_0003s16870.1 | 3e-32 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.3 | 1e-27 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.2188s0030.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|