PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.1404s0020.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 24331.6 Da PI: 9.2987 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.2 | 1.4e-16 | 12 | 59 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT eEd +l d v+ +G+g W++I++ g++R++k+c++rw +yl SapurV1A.1404s0020.1.p 12 RGLWTVEEDRILTDHVRVHGKGKWNRIPKLTGLKRCGKSCRLRWVNYL 59 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 61.2 | 2.2e-19 | 65 | 110 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eEd+l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l SapurV1A.1404s0020.1.p 65 RGVFSEEEDDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 110 899*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.137 | 7 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.36E-30 | 10 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.9E-13 | 11 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-14 | 12 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.2E-22 | 13 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.01E-10 | 15 | 59 | No hit | No description |
PROSITE profile | PS51294 | 28.655 | 60 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-18 | 64 | 112 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.2E-18 | 65 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-26 | 67 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.83E-13 | 68 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045165 | Biological Process | cell fate commitment | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MKGAAGNGEH RRGLWTVEED RILTDHVRVH GKGKWNRIPK LTGLKRCGKS CRLRWVNYLS 60 PGVKRGVFSE EEDDLIIRLH KLLGNRWSLI AGRVPGRTDN QVKNHWNTHL SKKLGVKQRK 120 CKINASSSKS SKESGANSRT ELKSNDDGSI SCRKGEAEIH NVIEDSSEKV RETTSLQDPL 180 LIGDCYDNFW DPYLCAPNLM EFLDQSLDLF WDGM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-28 | 7 | 114 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.1404s0020.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011044303.1 | 1e-122 | PREDICTED: transcription factor WER-like | ||||
Swissprot | Q9SEI0 | 2e-65 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | B9I398 | 1e-119 | B9I398_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0012s08190.1 | 1e-120 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 2e-67 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.1404s0020.1.p |