PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0171s0340.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 198aa MW: 22342.1 Da PI: 4.7238 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 97 | 2.8e-30 | 10 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 lppGf F+Ptdeelv ++L++k++ + + ++i+++ +y ++Pw+L+ k+ ++ ++wy+Fs+ +k ++t++g+Wk SapurV1A.0171s0340.1.p 10 LPPGFVFSPTDEELVLHFLHRKASPLPSNP-SIIPDLTLYPHDPWQLEGKALSSGNQWYYFSQVMEK--------KVTENGFWKPLD 87 79************************9877.78***************77778899******98775........5899******** PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++v+++ g++vglkk +v+ + +g++t+W+m+ey+l SapurV1A.0171s0340.1.p 88 IEEPVFCNAGKKVGLKKYFVYC--NGAEGVETNWMMKEYHL 126 *********************9..667899*********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.11E-37 | 9 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 36.557 | 10 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-18 | 11 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MGDHGYSGNL PPGFVFSPTD EELVLHFLHR KASPLPSNPS IIPDLTLYPH DPWQLEGKAL 60 SSGNQWYYFS QVMEKKVTEN GFWKPLDIEE PVFCNAGKKV GLKKYFVYCN GAEGVETNWM 120 MKEYHLCSSK SSGTSSCKKK KKSDCHEWIL CRVYEREGSC IQNVGNSTED DDGTELSCLD 180 EMFLSMDDDL DDISFPK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-28 | 9 | 160 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-28 | 9 | 160 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-28 | 9 | 160 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-28 | 9 | 160 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swm_B | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swm_C | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swm_D | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swp_A | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swp_B | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swp_C | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
3swp_D | 7e-28 | 9 | 160 | 19 | 172 | NAC domain-containing protein 19 |
4dul_A | 8e-28 | 9 | 160 | 16 | 169 | NAC domain-containing protein 19 |
4dul_B | 8e-28 | 9 | 160 | 16 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0171s0340.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC216598 | 7e-77 | AC216598.1 Populus trichocarpa clone POP037-D13, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002310519.1 | 1e-124 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 1e-58 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | B9HES9 | 1e-122 | B9HES9_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0007s04250.1 | 1e-123 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 1e-58 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0171s0340.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|