PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0107s0060.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 145aa MW: 15956.6 Da PI: 10.7903 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 63.5 | 2.5e-20 | 29 | 64 | 1 | 36 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 C+ C+ttkTplWR gp g+k+LCnaCG++yrkk+++ SapurV1A.0107s0060.1.p 29 CTDCKTTKTPLWRGGPAGPKSLCNACGIRYRKKRTM 64 *********************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.571 | 23 | 59 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.2E-15 | 23 | 75 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.57E-14 | 26 | 69 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.5E-16 | 27 | 63 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.58E-14 | 28 | 77 | No hit | No description |
Pfam | PF00320 | 3.7E-18 | 29 | 64 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 29 | 54 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MDLKGRKSSR EDDRGGGGVS GEVEDKKACT DCKTTKTPLW RGGPAGPKSL CNACGIRYRK 60 KRTMMRLEKG PEKKREKTTS SNTTSGSGLN SESLRMSVMV LGEEMMLQRP PIVKKKRCRR 120 KRKLREEEQA ALSLMALSCG SVFA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 118 | 124 | RRKRKLR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0107s0060.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006382425.1 | 5e-73 | GATA transcription factor 16 | ||||
Swissprot | Q9FJ10 | 2e-28 | GAT16_ARATH; GATA transcription factor 16 | ||||
TrEMBL | B9N4N6 | 1e-71 | B9N4N6_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0005s02040.1 | 2e-72 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1569 | 32 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 3e-16 | GATA transcription factor 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0107s0060.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|