PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00030400-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 160aa MW: 18137.4 Da PI: 5.7232 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 32.6 | 2.1e-10 | 23 | 64 | 2 | 43 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpk 43 Fl+k+ye ++d++++ ++sws+ +nsfvv+d+++f+ ++Lp+ SMil_00030400-RA_Salv 23 FLSKTYEFVDDPRTDPIVSWSRGNNSFVVWDPQNFSINLLPR 64 9************************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.2E-12 | 14 | 64 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 2.18E-18 | 19 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.9E-28 | 19 | 92 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.7E-7 | 23 | 64 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 8.8E-5 | 65 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MYSDAMEIPQ PNEALHENAP PPFLSKTYEF VDDPRTDPIV SWSRGNNSFV VWDPQNFSIN 60 LLPRKVDPDK WEFANEGFLK GQRHLLKTIK RRKQTGTTNI AQGATNCQGF ESCVEVGSFG 120 LDGEIERLKR DKSVLMMELV KLRQQQQQTS SHIQGDGGEA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 85 | 91 | LKTIKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020552814.1 | 1e-67 | heat stress transcription factor A-2c | ||||
Swissprot | Q9LUH8 | 7e-58 | HFA6B_ARATH; Heat stress transcription factor A-6b | ||||
TrEMBL | A0A4D8YYT5 | 1e-66 | A0A4D8YYT5_SALSN; Heat shock transcription factor, other eukaryote | ||||
STRING | XP_009797496.1 | 4e-65 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA572 | 24 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 8e-57 | heat shock transcription factor A6B |