PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

SBP

Protein Properties

Length: 228aa MW: 25164.2 Da PI: 8.5977

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00026506-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	128.5	2.5e-40	25	101	2	78
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 C v+gC+adls +++yhrrhkvCe+hsk+p+v++ g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+qa SMil_00026506-RA_Salv 25 CLVDGCSADLSVCRDYHRRHKVCEAHSKTPKVTIGGREQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKAQA 101 **************************************************************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.8E-33	19	86	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.752	22	99	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.35E-37	23	102	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.3E-30	25	98	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048653	Biological Process	anther development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 228 aa Download sequence Send to blast
LRSMESSSSS KRAKAPANVA QVAHCLVDGC SADLSVCRDY HRRHKVCEAH SKTPKVTIGG 60 REQRFCQQCS RFHSLVEFDE GKRSCRKRLD GHNRRRRKAQ ARSVTGVEER LVSFSSSAPQ 120 IVAGGGVVGY PWSGVVVKDE NEIGALQQQL NYMDSAASAA HHHHHQHQLS SSPAFVDPNV 180 MMECDGALSL LSSPPPAIID YHQTTSPTLH FPHQNVGSSH QTLSFMWD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-28	25	98	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00555	DAP	Transfer from AT5G50570	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040}.
UniProt	INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305\|PubMed:16861571}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF437890	0.0	KF437890.1 Salvia miltiorrhiza SQUAMOSA promoter binding protein-like 14 (SPL14) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001311938.1	2e-61	teosinte glume architecture 1-like
Refseq	XP_009621035.1	2e-61	PREDICTED: teosinte glume architecture 1-like
Refseq	XP_009621036.1	2e-61	PREDICTED: teosinte glume architecture 1-like
Refseq	XP_009621037.1	2e-61	PREDICTED: teosinte glume architecture 1-like
Refseq	XP_009621038.1	2e-61	PREDICTED: teosinte glume architecture 1-like
Refseq	XP_016443564.1	2e-61	PREDICTED: teosinte glume architecture 1-like isoform X1
Refseq	XP_016443565.1	2e-61	PREDICTED: teosinte glume architecture 1-like isoform X1
Refseq	XP_016443566.1	2e-61	PREDICTED: teosinte glume architecture 1-like isoform X1
Refseq	XP_016443567.1	2e-61	PREDICTED: teosinte glume architecture 1-like isoform X1
Swissprot	B9DI20	2e-40	SP13A_ARATH; Squamosa promoter-binding-like protein 13A
Swissprot	P0DI11	2e-40	SP13B_ARATH; Squamosa promoter-binding-like protein 13B
Swissprot	Q6YZE8	1e-39	SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBL	A0A075FJP6	1e-166	A0A075FJP6_SALMI; SQUAMOSA promoter binding protein-like 14 (Fragment)
STRING	XP_009621034.1	7e-61	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4920	20	37

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G50670.1	2e-42	SBP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Wang S, et al. Control of grain size, shape and quality by OsSPL16 in rice. Nat. Genet., 2012. 44(8): p. 950-4 [PMID:22729225] Zhang L, et al. Genome-wide analysis and molecular dissection of the SPL gene family in Salvia miltiorrhiza. J Integr Plant Biol, 2014. 56(1): p. 38-50 [PMID:24112769] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Wang S, et al. The OsSPL16-GW7 regulatory module determines grain shape and simultaneously improves rice yield and grain quality. Nat. Genet., 2015. 47(8): p. 949-54 [PMID:26147620] Wang Y, et al. A comprehensive meta-analysis of plant morphology, yield, stay-green, and virus disease resistance QTL in maize (Zea mays L.). Planta, 2016. 243(2): p. 459-71 [PMID:26474992] Lee CM, et al. Influence of Multi-Gene Allele Combinations on Grain Size of Rice and Development of a Regression Equation Model to Predict Grain Parameters. Rice (N Y), 2015. 8(1): p. 33 [PMID:26519289] Bessho-Uehara K, et al. Loss of function at RAE2, a previously unidentified EPFL, is required for awnlessness in cultivated Asian rice. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(32): p. 8969-74 [PMID:27466405] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584]